P25063 CD24_HUMAN

Gene name: CD24
Protein name: Signal transducer CD24

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WVD3 RNF138 0.76265 cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
2 P49841 GSK3B 0.66582 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
3 Q06330 RBPJ 0.62462 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 O43679 LDB2 0.62251 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
5 Q5SSG8 MUC21 0.59466 biosynthetic process GO:0009058
cell adhesion GO:0007155
cellular protein modification process GO:0006464
...
6 Q9H8U3 ZFAND3 0.57052
7 Q86X10 RALGAPB 0.56676 signal transduction GO:0007165
8 Q96SI9 STRBP 0.55333 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
9 P42345 MTOR 0.54301 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
10 Q92765 FRZB 0.54177 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                    
AA:                      MGRAMVARLGLGLLLLALLLPTQIYSSETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSS                                                      
DO_DISOPRED3:            D......D..D.......................DDDDDDDDDDDDDDDDDDDDDDDDD.....................
DO_IUPRED2A:             ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................
CONSENSUS:                                         ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................
CONSENSUS_MOBI:                                    .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
RICH_[AN]:                                                               NptNAttkAA                      
RICH_[AT]:                                                       TsnsglApnpTnATTkAA                      
RICH_[N]:                                                   NssqstsNsglapNptN                            
RICH_[S]:                                                 SSnSSqStSnS                                    
RICH_[T]:                                            TTTgTssnssqsT                                       
RICH_[ST]:                                           TTTgTSSnSSqSTSnS                                    
RICH_[NS]:                                                SSNSSqStSNSglapNptN                            
RICH_[NT]:                                                  NssqsTsNsglapNpTNaTT                         
RICH_fLPS_[S]:                                        ttgtSSnSSqStSnS                                    
RICH_MOBI_[AN]:                                                          NptNAttkAA                      
RICH_MOBI_[AT]:                                                  TsnsglApnpTnATTkAA                      
RICH_MOBI_[N]:                                              NssqstsNsglapNptN                            
RICH_MOBI_[S]:                                            SSnSSqStSnS                                    
RICH_MOBI_[T]:                                       TTTgTssnssqsT                                       
RICH_MOBI_[ST]:                                      TTTgTSSnSSqSTSnS                                    
RICH_MOBI_[NS]:                                           SSNSSqStSNSglapNptN                            
RICH_MOBI_[NT]:                                             NssqsTsNsglapNpTNaTT                         
RICH_fLPS_MOBI_[S]:                                       SSnSSqStSnS