Q8WVD3 RN138_HUMAN
Gene name: RNF138
Protein name: E3 ubiquitin-protein ligase RNF138
List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- DNA metabolic process GO:0006259
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P25063 | CD24 | 0.76265 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 2 | Q9H8U3 | ZFAND3 | 0.65394 | |
| 3 | O43679 | LDB2 | 0.65294 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q06330 | RBPJ | 0.64486 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q9UHC1 | MLH3 | 0.64436 | cell cycle GO:0007049 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q12926 | ELAVL2 | 0.60078 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 7 | Q5U623 | ATF7IP2 | 0.59849 | |
| 8 | Q96SI9 | STRBP | 0.59008 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 9 | P40426 | PBX3 | 0.58805 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | P05771 | PRKCB | 0.56393 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MAEDLSAATSYTEDDFYCPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYRMRH STMI: DO_DISOPRED3: DDDDDDDDDDDD........................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDD..................................................DDDDDDDDDDDDDD.....DDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDD........................................................................................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: HYKSCKKYQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQENTSSSGHPTFKCPLCQESNFTRQRLLDHCNSNHLFQIVPVTCPICVSLPWGDP STMI: DO_DISOPRED3: ............................DDDDDDDDDDDDDDDDDD...................................................... DO_IUPRED2A: ...........................DDDDDDDDDDDDDDDDDDDDD.D.................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................ CONSENSUS: ...........................DDDDDDDDDDDDDDDDDDDDDDD.................................................. CONSENSUS_MOBI: ........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................. RICH_[N]: NsNrsetstsdNtetyqeN RICH_[T]: TsTsdnTeTyqenT RICH_[NS]: NSNrSetStS RICH_[NT]: NsNrseTsTsdNTeTyqeNT RICH_MOBI_[N]: NsNrsetstsdNtetyqeN RICH_MOBI_[T]: TsTsdnTeTyqenT RICH_MOBI_[ST]: SeTSTSdnTeTyqenTSSS RICH_MOBI_[NS]: SvgNSNrSetStSdN RICH_MOBI_[NT]: NsNrseTsTsdNTeTyqeNT
220 240 AA: SQITRNFVSHLNQRHQFDYGEFVNLQLDEETQYQTAVEESFQVNI STMI: DO_DISOPRED3: ............................................D DO_IUPRED2A: ............................................. DO_SPOTD: .........................................DDDD CONSENSUS: ............................................D CONSENSUS_MOBI: .............................................