P25788 PSA3_HUMAN
Gene name: PSMA3
Protein name: Proteasome subunit alpha type-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- nucleobase-containing compound catabolic process GO:0034655
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8N1C3 | GABRG1 | 0.83205 |
cell-cell signaling
GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
2 | Q9NUN5 | LMBRD1 | 0.75569 |
biological process involved in symbiotic interaction
GO:0044403 small molecule metabolic process GO:0044281 |
3 | Q92882 | OSTF1 | 0.7361 |
immune system process
GO:0002376 signal transduction GO:0007165 transport GO:0006810 ... |
4 | P62495 | ETF1 | 0.73106 |
biosynthetic process
GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
5 | Q8NE00 | TMEM104 | 0.7175 | |
6 | Q9Y6J8 | STYXL1 | 0.70711 |
anatomical structure development
GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
7 | Q8N485 | LIX1 | 0.70711 |
catabolic process
GO:0009056 |
8 | P29972 | AQP1 | 0.68662 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
9 | Q6NVV0 | MKRN9P | 0.66227 | |
10 | Q9NZC7 | WWOX | 0.64847 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
20 40 60 80 100
AA: MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYEEGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFR
STMI:
DO_DISOPRED3: DDDDD...............................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: DDDDD...............................................................................................
CONSENSUS: DDDDD...............................................................................................
CONSENSUS_MOBI: D...................................................................................................
120 140 160 180 200
AA: SNFGYNIPLKHLADRVAMYVHAYTLYSAVRPFGCSFMLGSYSVNDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKLQMKEMTCRDIVKEVAKIIYI
STMI:
DO_DISOPRED3: ....................................................................................................
DO_IUPRED2A: ....................................................................................................
DO_SPOTD: ....................................................................................................
CONSENSUS: ....................................................................................................
CONSENSUS_MOBI: ....................................................................................................
220 240
AA: VHDEVKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDNM
STMI:
DO_DISOPRED3: ..........................................DDDDDDDDDDDDD
DO_IUPRED2A: ...........................D.........DDDDDDDDDDDDDDDDDD
DO_SPOTD: .........................................DDDDDDDDDDDDDD
CONSENSUS: .........................................DDDDDDDDDDDDDD
CONSENSUS_MOBI: ..............................................DDDDDDDDD
RICH_fLPS_[D]: lkeeDesDDD