P27348 1433T_HUMAN
Gene name: YWHAQ
Protein name: 14-3-3 protein theta
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- membrane organization GO:0061024
- protein targeting GO:0006605
- protein transport GO:0015031
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N7F7 | UBL4B | 0.99041 | protein targeting GO:0006605 protein transport GO:0015031 transport GO:0006810 |
| 2 | O95674 | CDS2 | 0.98401 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 |
| 3 | Q96C86 | DCPS | 0.95415 | catabolic process GO:0009056 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q2KHN1 | RNF151 | 0.94272 | cell differentiation GO:0030154 cellular protein modification process GO:0006464 reproduction GO:0000003 |
| 5 | A6NES4 | MROH2A | 0.90889 | |
| 6 | Q15013 | MAD2L1BP | 0.88188 | cell cycle GO:0007049 mitotic cell cycle GO:0000278 mitotic nuclear division GO:0140014 |
| 7 | P09493 | TPM1 | 0.86585 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 8 | Q2VPB7 | AP5B1 | 0.82124 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | P61925 | PKIA | 0.79702 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q9UPT9 | USP22 | 0.78087 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLEL STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DD.................................................................................................. CONSENSUS: D................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: LDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAI STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: AELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN STMI: DO_DISOPRED3: .................................DDDDDDDDDDDD DO_IUPRED2A: ...................................DDDDDDDDDD DO_SPOTD: ...............................DDDDDDDDDDDDDD CONSENSUS: .................................DDDDDDDDDDDD CONSENSUS_MOBI: ..............................DDDDDDDDDDDDDDD RICH_[AE]: EEcdAAEgAE RICH_[E]: EEcdaaEgaE RICH_MOBI_[AE]: EEcdAAEgAE RICH_MOBI_[E]: EEcdaaEgaE