P61925 IPKA_HUMAN

Gene name: PKIA
Protein name: cAMP-dependent protein kinase inhibitor alpha

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- mitotic cell cycle GO:0000278
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P09681 GIP 0.98191 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell-cell signaling GO:0007267
...
2 P09493 TPM1 0.97719 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
3 Q9NSD4 ZNF275 0.8654
4 O15427 SLC16A3 0.86345 immune system process GO:0002376
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...
5 Q6UX27 VSTM1 0.83561 immune system process GO:0002376
6 P35250 RFC2 0.83116 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
7 O14986 PIP5K1B 0.8139 biosynthetic process GO:0009058
signal transduction GO:0007165
8 Q2KHN1 RNF151 0.80338 cell differentiation GO:0030154
cellular protein modification process GO:0006464
reproduction GO:0000003
9 Q86XW9 NME9 0.79796 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
10 P27348 YWHAQ 0.79702 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...

                                           20                  40                  60    
AA:                      MTDVETTYADFIASGRTGRRNAIHDILVSSASGNSNELALKLAGLDINKTEGEEDAQRSSTEQSGEAQGEAAKSES
STMI:                                                                                                
DO_DISOPRED3:            DDDD..............................................DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ......DDDDDD.DD......DDDDDDDD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDD......DDDDDDDD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDD....................DDDD.........................DDDDDDDDDDDDDDDDDDDDDD
RICH_[AE]:                                                                   EEdAqrsstEqsgEAqgEAAksE 
RICH_[E]:                                                                  EgEEdaqrsstEqsgEaqgE      
RICH_MOBI_[AE]:                                                                 AqrsstEqsgEAqgEAAksE