Q86TA1 MOB3B_HUMAN
Gene name: MOB3B
Protein name: MOB kinase activator 3B
List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q70IA8 | MOB3C | 0.89451 | |
| 2 | Q6UXG2 | ELAPOR1 | 0.85263 | catabolic process GO:0009056 cellular component assembly GO:0022607 response to stress GO:0006950 |
| 3 | Q96BX8 | MOB3A | 0.82124 | |
| 4 | P43155 | CRAT | 0.79532 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 protein targeting GO:0006605 ... |
| 5 | O14530 | TXNDC9 | 0.61965 | |
| 6 | P09543 | CNP | 0.61386 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | Q9UN76 | SLC6A14 | 0.61145 | transmembrane transport GO:0055085 transport GO:0006810 |
| 8 | Q9Y3N9 | OR2W1 | 0.6029 | |
| 9 | Q9Y6A9 | SPCS1 | 0.6029 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
| 10 | P63151 | PPP2R2A | 0.6029 | catabolic process GO:0009056 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIYGTICEFCTERTCPVMSGGPKYEYRW STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[F]: FnkdktFrpkrkF RICH_[K]: KqvfnKdKtfrpKrK RICH_[FK]: KqvFnKdKtFrpKrK
120 140 160 180 200 AA: QDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQICKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLID STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: RKELEPLKEMTSRMCH STMI: DO_DISOPRED3: ................ DO_IUPRED2A: ................ DO_SPOTD: ................ CONSENSUS: ................ CONSENSUS_MOBI: ................