Q8TDP1 RNH2C_HUMAN
Gene name: RNASEH2C
Protein name: Ribonuclease H2 subunit C
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q14953 | KIR2DS5 | 0.94061 | immune system process GO:0002376 response to stress GO:0006950 |
| 2 | Q14952 | KIR2DS3 | 0.93556 | response to stress GO:0006950 |
| 3 | Q6PGQ1 | DRICH1 | 0.85986 | |
| 4 | Q9Y5F3 | PCDHB1 | 0.83523 | cell adhesion GO:0007155 |
| 5 | P01275 | GCG | 0.83482 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell death GO:0008219 ... |
| 6 | Q8NCS7 | SLC44A5 | 0.82867 | biosynthetic process GO:0009058 transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q7Z7H8 | MRPL10 | 0.82783 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 8 | Q969E8 | TSR2 | 0.82478 | cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 |
| 9 | P48723 | HSPA13 | 0.8247 | protein folding GO:0006457 response to stress GO:0006950 transport GO:0006810 ... |
| 10 | Q00LT1 | PRCD | 0.8247 | nervous system process GO:0050877 |
20 40 60 80 100 AA: MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLR STMI: DO_DISOPRED3: DDDDDDDDD.DDDDDD...........................................................................DDDDDDDDD DO_IUPRED2A: DDDDDDDDDDDDDD................................DDDD........................................DDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDD.D.DDDDDD...................................................................DDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDD...........................................................................DDDDDDDDDD CONSENSUS_MOBI: DDDDDD......................................................................................DDDDDDDD RICH_[D]: Dplr RICH_[DE]: Dplr RICH_fLPS_[D]: Dplr RICH_MOBI_[D]: Dplr
120 140 160 AA: DSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED STMI: DO_DISOPRED3: DDDDDDDDDDDDD................................................DDD DO_IUPRED2A: DDDDDDDDDDDDDDD.............................................D..D DO_SPOTD: DDDDDDDDDDDDDDD.............................................DDDD CONSENSUS: DDDDDDDDDDDDDDD.............................................DDDD CONSENSUS_MOBI: DDDDDDD........................................................D RICH_[D]: DsgtDDqeeeplerD RICH_[DE]: DsgtDDqEEEplErD RICH_fLPS_[D]: DsgtDD RICH_MOBI_[D]: DsgtDD