P30626 SORCN_HUMAN
Gene name: SRI
Protein name: Sorcin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- homeostatic process GO:0042592
- protein transport GO:0015031
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P28676 | GCA | 0.80003 | immune system process GO:0002376 membrane organization GO:0061024 transport GO:0006810 ... |
| 2 | O43707 | ACTN4 | 0.70375 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 3 | P31943 | HNRNPH1 | 0.69872 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 4 | P17509 | HOXB6 | 0.68727 | anatomical structure development GO:0048856 embryo development GO:0009790 homeostatic process GO:0042592 ... |
| 5 | P20073 | ANXA7 | 0.66072 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 6 | Q13151 | HNRNPA0 | 0.65093 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 7 | O15155 | BET1 | 0.6504 | cellular component assembly GO:0022607 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 8 | P17275 | JUNB | 0.64333 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 9 | Q9UBV8 | PEF1 | 0.62794 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
| 10 | O95429 | BAG4 | 0.62066 | cell adhesion GO:0007155 cell death GO:0008219 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWA STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: .............DD........DDDD......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDDDDDD...DDDDDDDDDD........................................................................... RICH_[PY]: YPghPgagggYYPggYggaP RICH_[G]: GhpGaGGGyypGGyGGapGGpafpG RICH_[Y]: YpghpgagggYYpggY RICH_[GP]: PGhPGaGGGyyPGGyGGaPG RICH_[GY]: YpGhpGaGGGYYpGGYGGapGGpafpG RICH_fLPS_[GY]: YpGhpGaGGGYYpGGYGGapGG RICH_fLPS_[G]: GhpGaGGGyypGGyGGapGG RICH_fLPS_[Y]: maYpghpgagggYYpggYgg RICH_fLPS_MOBI_[G]: GGyGGapGGp
120 140 160 180 AA: VLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV STMI: DO_DISOPRED3: .................................................................................................. DO_IUPRED2A: ......................D........................................................................... DO_SPOTD: .................................................................................................. CONSENSUS: .................................................................................................. CONSENSUS_MOBI: ..................................................................................................