O15155 BET1_HUMAN
Gene name: BET1
Protein name: BET1 homolog
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P30626 | SRI | 0.6504 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell-cell signaling GO:0007267 ... |
| 2 | P31943 | HNRNPH1 | 0.63455 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 3 | Q9BUN8 | DERL1 | 0.62193 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 4 | P98179 | RBM3 | 0.62 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 5 | O43707 | ACTN4 | 0.61357 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 6 | Q8NE65 | ZNF738 | 0.60567 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 7 | P52597 | HNRNPF | 0.60312 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 signal transduction GO:0007165 |
| 8 | P28676 | GCA | 0.58451 | immune system process GO:0002376 membrane organization GO:0061024 transport GO:0006810 ... |
| 9 | P55795 | HNRNPH2 | 0.57572 | cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 |
| 10 | Q9Y263 | PLAA | 0.56088 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQTKLLCYM STMI: MMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... DO_IUPRED2A: .DDD................................................................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D...DDDD.DDDDDD.DDD.DD..DD............DD..DD.DD.DDDDDDD....... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................... CONSENSUS_MOBI: .......................DDD.................................................................... RICH_[G]: GlGeGvppGnyGnyGyansG RICH_[Y]: YgnYgYansgY RICH_[GN]: GvppGNyGNyGyaN RICH_[GY]: GlGeGvppGnYGnYGYansGY RICH_[NY]: NYgNYgYaNsgY RICH_fLPS_[G]: GlGeGvppGnyGnyGyansG RICH_fLPS_[Y]: lgegvppgnYgnYgYansgY RICH_fLPS_[YG]: GlGeGvppGnYGnYGYansGY
AA: MLFSLFVFFIIYWIIKLR STMI: MMMMMMMMMMMMMMM DO_DISOPRED3: .................. DO_IUPRED2A: .................. DO_SPOTD: ......DDDDDDDDDDDD CONSENSUS: ... CONSENSUS_MOBI: ...