P31371 FGF9_HUMAN
Gene name: FGF9
Protein name: Fibroblast growth factor 9
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell division GO:0051301
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- growth GO:0040007
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- reproduction GO:0000003
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8N2K1 | UBE2J2 | 0.70632 | catabolic process GO:0009056 cellular protein modification process GO:0006464 protein targeting GO:0006605 ... |
| 2 | Q16850 | CYP51A1 | 0.60948 | biosynthetic process GO:0009058 catabolic process GO:0009056 protein transport GO:0015031 ... |
| 3 | P45877 | PPIC | 0.59899 | cellular protein modification process GO:0006464 protein folding GO:0006457 |
| 4 | Q6NX45 | ZNF774 | 0.54978 | |
| 5 | Q9UF12 | PRODH2 | 0.52447 | catabolic process GO:0009056 small molecule metabolic process GO:0044281 |
| 6 | Q86V86 | PIM3 | 0.52407 | cell cycle GO:0007049 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
| 7 | O75610 | LEFTY1 | 0.51124 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q8TB61 | SLC35B2 | 0.50702 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 signal transduction GO:0007165 ... |
| 9 | O75616 | ERAL1 | 0.50702 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | Q86XS8 | RNF130 | 0.49221 | catabolic process GO:0009056 cell death GO:0008219 |
20 40 60 80 100 AA: MAPLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISI STMI: DO_DISOPRED3: DDDD...DDDD.DD.DDD.DDDDD..D.D.DDDDDDDDDDDDDDDDDDDDDDD............................................... DO_IUPRED2A: ............................................D....................................................... DO_SPOTD: DDDD........D...DDDD.DDDDD...DDDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS: DDDD........DDDDDDDDDDDD......DDDDDDDDDDDDDDDDDDDDDD................................................ CONSENSUS_MOBI: ..................................DDDDDDDDDDDDDD.................................................... RICH_[V]: VqdaVpfgnV RICH_[GL]: LLsdhLGqseaGGLprG
120 140 160 180 200 AA: AVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPEL STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..................................................................DDDDDDDDDDDDDDDD.DDD.............. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: YKDILSQS STMI: DO_DISOPRED3: D......D DO_IUPRED2A: ........ DO_SPOTD: .....DDD CONSENSUS: .......D CONSENSUS_MOBI: ........