P31947 1433S_HUMAN
Gene name: SFN
Protein name: 14-3-3 protein sigma
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- growth GO:0040007
- homeostatic process GO:0042592
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- nucleocytoplasmic transport GO:0006913
- protein transport GO:0015031
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P52790 | HK3 | 0.99746 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | A4D2B0 | MBLAC1 | 0.98332 | |
| 3 | Q13308 | PTK7 | 0.87295 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 4 | O00548 | DLL1 | 0.74024 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q5ZPR3 | CD276 | 0.73027 | cell adhesion GO:0007155 cell population proliferation GO:0008283 immune system process GO:0002376 ... |
| 6 | Q9H2G9 | BLZF1 | 0.72565 | growth GO:0040007 protein transport GO:0015031 transport GO:0006810 ... |
| 7 | Q6P4H8 | ATPSCKMT | 0.70711 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 8 | Q9P2K6 | KLHL42 | 0.70711 | catabolic process GO:0009056 cell cycle GO:0007049 cell division GO:0051301 ... |
| 9 | Q6ZV77 | C9orf139 | 0.68702 | |
| 10 | Q6NXR0 | IRGC | 0.68226 |
20 40 60 80 100 AA: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVL STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ...................................................................DDDDDDDDDDDDDDDDDD............... DO_SPOTD: .......................................................................D............................ CONSENSUS: .......................................................................D............................ CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: GLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .....................................................DDDDDDDDDD..................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 AA: AMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS STMI: DO_DISOPRED3: ...................................DDDDDDDDDDDDD DO_IUPRED2A: ..............................D.DDDDDDDDDDDDDDDD DO_SPOTD: .................................DDDDDDDDDDDDDDD CONSENSUS: .................................DDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................DDDDDDDDDDDDDDD RICH_[EG]: GEEGGEapqE RICH_MOBI_[EG]: GEEGGEapqE