P41208 CETN2_HUMAN
Gene name: CETN2
Protein name: Centrin-2
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- chromosome organization GO:0051276
- cytoskeleton organization GO:0007010
- DNA metabolic process GO:0006259
- mitotic cell cycle GO:0000278
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
- response to stress GO:0006950
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y3N9 | OR2W1 | 0.76877 | |
| 2 | Q9Y6A9 | SPCS1 | 0.76877 | biological process involved in symbiotic interaction GO:0044403 cellular nitrogen compound metabolic process GO:0034641 protein maturation GO:0051604 ... |
| 3 | Q6P2S7 | TTC41P | 0.70539 | |
| 4 | P46059 | SLC15A1 | 0.68761 | protein transport GO:0015031 transmembrane transport GO:0055085 transport GO:0006810 |
| 5 | P78348 | ASIC1 | 0.68761 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 6 | Q9NXB9 | ELOVL2 | 0.68332 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 7 | Q86V20 | SHLD2 | 0.6803 | anatomical structure development GO:0048856 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 8 | Q5FWF6 | ZNF789 | 0.67202 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q8TCF1 | ZFAND1 | 0.66263 | protein transport GO:0015031 transport GO:0006810 |
| 10 | Q5JPI3 | C3orf38 | 0.66263 | cell death GO:0008219 |
20 40 60 80 100 AA: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ...DDDDDDDDDDDDDDDDDDDDDDDDDDDD....DD.................................DDDDD......................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AN]: AsNfkkANmA RICH_[K]: KKanmasssqrKrmspK RICH_[MN]: MasNfkkaNM
120 140 160 AA: DTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY STMI: DO_DISOPRED3: ......................................DDDDDDDDDDDDDDDDD................. DO_IUPRED2A: .......................................DDDDDDDDDDDDDDD..DD.D............ DO_SPOTD: .....................................................................DDD CONSENSUS: .......................................DDDDDDDDDDDDDDD.................. CONSENSUS_MOBI: ........................................................................