Q9NXB9 ELOV2_HUMAN
Gene name: ELOVL2
Protein name: Elongation of very long chain fatty acids protein 2
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5VTE0 | EEF1A1P5 | 0.94463 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 2 | Q8NI60 | COQ8A | 0.93086 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 small molecule metabolic process GO:0044281 |
| 3 | Q9H6D3 | XKR8 | 0.86197 | anatomical structure development GO:0048856 cell death GO:0008219 membrane organization GO:0061024 ... |
| 4 | Q96DX8 | RTP4 | 0.82562 | immune system process GO:0002376 membrane organization GO:0061024 nervous system process GO:0050877 ... |
| 5 | Q9BTE7 | DCUN1D5 | 0.8175 | cellular protein modification process GO:0006464 |
| 6 | Q71UI9 | H2AZ2 | 0.79752 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 |
| 7 | Q9NVR7 | TBCCD1 | 0.7936 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 |
| 8 | P17568 | NDUFB7 | 0.79067 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein-containing complex assembly GO:0065003 |
| 9 | P21741 | MDK | 0.75094 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | Q9NV29 | TMEM100 | 0.74269 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MEHLKAFDDEINAFLDNMFGPRDSRVRGWFMLDSYLPTFFLTVMYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLAELILSTWEGGYNLQCQ STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: D................................................................................................... CONSENSUS: D........................... ................. ............. CONSENSUS_MOBI: ............................ ................. .............
120 140 160 180 200 AA: DLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHASMFNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVFPSMHKYLW STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .............. ................. . ..... CONSENSUS_MOBI: .............. ................. . .....
220 240 260 280 AA: WKKYLTQAQLVQFVLTITHTMSAVVKPCGFPFGCLIFQSSYMLTLVILFLNFYVQTYRKKPMKKDMQEPPAGKEVKNGFSKAYFTAANGVMNKKAQ STMI: MMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...................................................................D............................ DO_SPOTD: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ....... .... .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....... .... .............................................. RICH_[AK]: KngfsKAyftAAngvmnKKA RICH_[AN]: AANgvmNkkA RICH_[K]: KpmKKdmqeppagKevKngfsK