P42574 CASP3_HUMAN
Gene name: CASP3
Protein name: Caspase-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- embryo development GO:0009790
- homeostatic process GO:0042592
- immune system process GO:0002376
- nervous system process GO:0050877
- nucleobase-containing compound catabolic process GO:0034655
- protein maturation GO:0051604
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q13324 | CRHR2 | 0.61874 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 2 | Q9H2U9 | ADAM7 | 0.61874 | |
| 3 | Q15121 | PEA15 | 0.49727 | cell cycle GO:0007049 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 4 | Q9Y6R6 | ZNF780B | 0.49499 | |
| 5 | Q13557 | CAMK2D | 0.48653 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P01011 | SERPINA3 | 0.48383 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 7 | Q8TDS4 | HCAR2 | 0.48383 | catabolic process GO:0009056 cell death GO:0008219 cell-cell signaling GO:0007267 ... |
| 8 | Q8IZF3 | ADGRF4 | 0.48383 | signal transduction GO:0007165 |
| 9 | Q8NA03 | FSIP1 | 0.46745 | |
| 10 | Q9BXY5 | CAPS2 | 0.44895 |
20 40 60 80 100 AA: MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDD...........DD..........................DDDD..DD.DD.............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ RICH_[I]: IknlepkIIhgsesmdsgI RICH_[IK]: KsIKnlepKI RICH_MOBI_[N]: NteNsvdsksikN RICH_MOBI_[IK]: KsIKnlepKI RICH_fLPS_MOBI_[I]: sIknlepkII
120 140 160 180 200 AA: RDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .DD................................................................................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: PGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH STMI: DO_DISOPRED3: ............................................................................. DO_IUPRED2A: ............................................................................. DO_SPOTD: ............................................................................. CONSENSUS: ............................................................................. CONSENSUS_MOBI: .............................................................................