Q15121 PEA15_HUMAN

Gene name: PEA15
Protein name: Astrocytic phosphoprotein PEA-15

List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cell death GO:0008219
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N608 DPP10 0.54972 transmembrane transport GO:0055085
transport GO:0006810
2 Q8NBZ7 UXS1 0.52257 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
3 O95470 SGPL1 0.51458 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 P42574 CASP3 0.49727 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
5 Q9Y5H5 PCDHA9 0.49216 cell adhesion GO:0007155
6 Q9Y223 GNE 0.48864
7 Q9UN73 PCDHA6 0.48736 anatomical structure development GO:0048856
cell adhesion GO:0007155
8 Q9Y5H6 PCDHA8 0.48623 anatomical structure development GO:0048856
cell adhesion GO:0007155
9 Q9Y5H8 PCDHA3 0.4716 anatomical structure development GO:0048856
cell adhesion GO:0007155
10 Q8IXT1 DDIAS 0.47115 cell cycle GO:0007049
cell death GO:0008219
mitotic cell cycle GO:0000278
...

                                           20                  40                  60                  80                 100
AA:                      MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLT
STMI:                                                                                                                        
DO_DISOPRED3:            ................................................................................................D...
DO_IUPRED2A:             ...........................D..DDDD.................................................................D
DO_SPOTD:                .......................................................................................DDDDDDDDDDDDD
CONSENSUS:               ................................................................................................DDDD
CONSENSUS_MOBI:          ..............................................................................................DDDDDD
RICH_MOBI_[K]:                                                                                                            Klt
RICH_MOBI_[IK]:                                                                                                           Klt

                                          120          
AA:                      RIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
STMI:                                                  
DO_DISOPRED3:            .....................DD.DDDDDD
DO_IUPRED2A:             ..................D..DDDDDD...
DO_SPOTD:                DDDDDDD..DDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..................DDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDD......DDD
RICH_[IK]:                                  IIKlapppKK 
RICH_MOBI_[I]:            IpsakkykdIIrqpseeeII         
RICH_MOBI_[K]:           ripsaKKyK                     
RICH_MOBI_[IK]:          rIpsaKKyKdII                  
RICH_fLPS_MOBI_[I]:       IpsakkykdIIrqpseeeII