P45973 CBX5_HUMAN
Gene name: CBX5
Protein name: Chromobox protein homolog 5
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cellular nitrogen compound metabolic process GO:0034641
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P29973 | CNGA1 | 0.72661 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 2 | Q8N3Z6 | ZCCHC7 | 0.59141 | |
| 3 | Q86UB2 | BIVM | 0.5886 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 4 | Q9BX26 | SYCP2 | 0.57663 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 5 | Q9NZI6 | TFCP2L1 | 0.57056 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q8TBB6 | SLC7A14 | 0.56809 | transport GO:0006810 |
| 7 | Q6ZUT1 | NKAPD1 | 0.56485 | |
| 8 | Q9Y5Y7 | LYVE1 | 0.56385 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell adhesion GO:0007155 ... |
| 9 | Q9Y421 | FAM32A | 0.55993 | cell cycle GO:0007049 cell death GO:0008219 |
| 10 | Q9H0A0 | NAT10 | 0.5511 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
20 40 60 80 100 AA: MGKKTKRTADSSSSEDEEEYVVEKVLDRRVVKGQVEYLLKWKGFSEEHNTWEPEKNLDCPELISEFMKKYKKMKEGENNKPREKSESNKRKSNFSNSADD STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD..............................................................DDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: DDDDDDDDDDDDDDDDDDD................................D..D.................DDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDD........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDD.......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_[K]: KegennKpreKsesnKrK RICH_[N]: NNkpreksesNkrksNfsN RICH_[S]: SeSnkrkSnfSnSadd RICH_[DI]: DD RICH_[EK]: KEgEnnKprEKsEsnKrK RICH_[EN]: EgENNkprEksEsNkrksN RICH_[KN]: KegeNNKpreKsesNKrKsNfsN RICH_[KS]: KSeSnKrKSnfSnSadd RICH_[NS]: SeSNkrkSNfSNS RICH_fLPS_[K]: snKrKsnfsnsadd RICH_fLPS_[NK]: KegeNNKpreKsesNKrKsNfsNsadd RICH_fLPS_[N]: eNNkpreksesNkrksNfsN RICH_MOBI_[K]: KyKKmKegennKpreKsesnKrK RICH_MOBI_[N]: NNkpreksesNkrksNfsN RICH_MOBI_[EK]: KyKKmKEgEnnKprEKsEsnKrK RICH_MOBI_[EN]: EgENNkprEksEsNkrksN RICH_MOBI_[KN]: KKmKegeNNKpreKsesNKrKsNfsN RICH_MOBI_[KS]: KSeSnKrKSnfSnSadd RICH_MOBI_[NS]: SeSNkrkSNfSNS RICH_fLPS_MOBI_[KN]: KyKKmKegeNNKpreKsesNKrKsNfsNsadd RICH_fLPS_MOBI_[K]: KyKKmKegennKpreKsesnKrKsnfsnsadd RICH_fLPS_MOBI_[N]: eNNkpreksesNkrksNfsN
120 140 160 180 AA: IKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETAKS STMI: DO_DISOPRED3: ...............................................................................DDDDDDDDDDDD DO_IUPRED2A: DDDDDDDDDD.DDDDD.............................................................DDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDD...........................................................DDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDD..............................................................DDDDDDDDDDDDD CONSENSUS_MOBI: DDDDDDDDDD......................D......................................DD.................. RICH_[S]: ikS RICH_[DI]: IkskkkreqsnDI RICH_[KS]: iKSK RICH_fLPS_[K]: iKsKKK RICH_fLPS_[NK]: iKsKKK RICH_MOBI_[KS]: iKSK RICH_fLPS_MOBI_[KN]: iKsKKK RICH_fLPS_MOBI_[K]: iKsKKK