P49450 CENPA_HUMAN

Gene name: CENPA
Protein name: Histone H3-like centromeric protein A

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell division GO:0051301
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- cytoskeleton organization GO:0007010
- mitotic cell cycle GO:0000278
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BQ13 KCTD14 0.91392 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
2 Q15560 TCEA2 0.87738 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q04912 MST1R 0.86678 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
4 Q8TAI1 TYMSOS 0.86367
5 Q3B8N2 LGALS9B 0.85634 cell adhesion GO:0007155
cell population proliferation GO:0008283
immune system process GO:0002376
6 Q8IY34 SLC15A3 0.82682 protein transport GO:0015031
transport GO:0006810
7 Q9H427 KCNK15 0.8243 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
8 Q86VR8 FJX1 0.8233 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell-cell signaling GO:0007267
9 Q13875 MOBP 0.81512 anatomical structure development GO:0048856
10 Q9BST9 RTKN 0.81144 cell cycle GO:0007049
cell death GO:0008219
cell division GO:0051301
...

                                           20                  40                  60                  80                 100
AA:                      MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDD...................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................................................
CONSENSUS_MOBI:          D.......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................
RICH_[PR]:                 PRRRsRkPeaPRRRsPsPtPtPgPsRRgP                                                                     
RICH_[P]:                  PrrrsrkPeaPrrrsPsPtPtP                                                                            
RICH_[R]:                   RRRsRkpeapRRRspsptptpgpsRR                                                                       
RICH_[HS]:                                              SlgaSSHqHS                                                           
RICH_fLPS_[R]:           mgpRRRsRkpeapRRRspsp                                                                                
RICH_MOBI_[PR]:                   PeaPRRRsPsPtPtPgPsRRgP                                                                     
RICH_MOBI_[P]:                    PeaPrrrsPsPtPtPgPsrrgP                                                                     
RICH_MOBI_[R]:                        RRRspsptptpgpsRR                                                                       
RICH_MOBI_[HS]:                                         SlgaSSHqHS                                                           

                                          120
AA:                      FLVHLFEDAYLLTLHAGRVTLFPKDVQLARRIRGLEEGLG
STMI:                                                            
DO_DISOPRED3:            ....................................DDDD
DO_IUPRED2A:             ........................................
DO_SPOTD:                ...................................DDDDD
CONSENSUS:               ....................................DDDD
CONSENSUS_MOBI:          ........................................