Q8TAI1 TYMOS_HUMAN

Gene name: TYMSOS
Protein name: TYMS opposite strand protein

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15560 TCEA2 0.87588 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 P49450 CENPA 0.86367 biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
cell division GO:0051301
...
3 Q7Z4H4 ADM2 0.85106 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular protein modification process GO:0006464
...
4 Q9BQ13 KCTD14 0.84954 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
5 Q86VR8 FJX1 0.82396 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell-cell signaling GO:0007267
6 Q8IY34 SLC15A3 0.82222 protein transport GO:0015031
transport GO:0006810
7 O75161 NPHP4 0.81445 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
8 P59051 BRWD1-AS2 0.80469
9 Q96A11 GAL3ST3 0.80423 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
10 Q16099 GRIK4 0.79781 cell-cell signaling GO:0007267
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MTPASGATASLGRLRARPRSRWDAAYLPAVAAVCVARASHVPNGTLRFGVCKARRTMRPLPRRIEVRTKRGPQRPAAPERSPQPRLPPSRHPSRRGPRRH
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDD.............................................................DDDDDDDDDDDDD.D...........
DO_IUPRED2A:             DDDDDDDDDDDDDDDD.D...........................DDDDDDDD.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDD...........................DDD....D.....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                                                         PlPRRievRtkRgPqRPaaPeR   PRlPPsRhPsRRgPRR 
RICH_[P]:                                                                                       PqrPaaPersPqPrlPPsrhPsrrgP   
RICH_[R]:                                                                             RRievRtkRgpqRpaapeRspqpRlppsRhpsRRgpRR 
RICH_[HR]:                                                                                                        RHpsRRgpRRH
RICH_fLPS_[R]:                                                                        RRievRtkRgpqRpaapeRspqpRlppsRhpsRRgpRR 
RICH_MOBI_[PR]:                                                                               RgPqRPaaPeRsPqPRlPPsRhPsRRgPRR 
RICH_MOBI_[P]:                                                                                  PqrPaaPersPqPrlPPsrhPsrrgP   
RICH_MOBI_[R]:                                                                    RplpRRievRtkRgpqRpaapeRspqpRlppsRhpsRRgpRRh
RICH_MOBI_[CR]:                                                                                                   RhpsRRgpRRh
RICH_MOBI_[HR]:                                                                                                   RHpsRRgpRRH
RICH_fLPS_MOBI_[R]:                                                                                          RlppsRhpsRRgpRR 

                                          120                 
AA:                      LSGCSAPACRIPTGCRCPCGRPS
STMI:                                           
DO_DISOPRED3:            ......................D
DO_IUPRED2A:             DDDD...................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD..................D
CONSENSUS_MOBI:          DDDDDDDDDDD............
RICH_MOBI_[R]:           lsgcsapacR             
RICH_MOBI_[CR]:          lsgCsapaCR