P50591 TNF10_HUMAN
Gene name: TNFSF10
Protein name: Tumor necrosis factor ligand superfamily member 10
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell-cell signaling GO:0007267
- immune system process GO:0002376
- reproduction GO:0000003
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y603 | ETV7 | 0.74968 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q9Y4E5 | ZNF451 | 0.74382 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 3 | Q9Y286 | SIGLEC7 | 0.73617 | cell adhesion GO:0007155 immune system process GO:0002376 |
| 4 | Q6P474 | PDXDC2P | 0.72188 | |
| 5 | Q9HCI6 | KIAA1586 | 0.69393 | cellular protein modification process GO:0006464 |
| 6 | Q9BZV2 | SLC19A3 | 0.61534 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 ... |
| 7 | Q8NF99 | ZNF397 | 0.61195 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q14571 | ITPR2 | 0.57827 | cell-cell signaling GO:0007267 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 9 | O00422 | SAP18 | 0.57363 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | P13521 | SCG2 | 0.56373 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
20 40 60 80 100 AA: MAMMEVQGGPSLGQTCVLIVIFTVLLQSLCVAVTYVYFTNELKQMQDKYSKSGIACFLKEDDSYWDPNDEESMNSPCWQVKWQLRQLVRKMILRTSEETI STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...D........................................................DDDD DO_IUPRED2A: ....................................................................D............................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD.................................................DDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDD ..........................................................DDDD CONSENSUS_MOBI: ................. ....................................................DDDDDDDDDD RICH_[IQ]: I RICH_fLPS_[M]: MaMMevqggp RICH_MOBI_[EI]: EEtI RICH_MOBI_[IQ]: I
120 140 160 180 200 AA: STVQEKQQNISPLVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGELVIHEKGFYYIYSQTYFRFQEEIKENT STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDD....................................................... DO_IUPRED2A: ..........DD.DD.....DD.DDDDDDDDDDDDDDDDDDDD...DDDD.................................................. DO_SPOTD: DDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDDD..................................................DDDD CONSENSUS: DDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDD....................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDD..................DDDD............................................................ RICH_[N]: NtlsspNskN RICH_[IQ]: stvQekQQnI RICH_MOBI_[EI]: stvqEkqqnIsplvrE RICH_MOBI_[IQ]: stvQekQQnI
220 240 260 280 AA: KNDKQMVQYIYKYTSYPDPILLMKSARNSCWSKDAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG STMI: DO_DISOPRED3: ................................................................................. DO_IUPRED2A: ................................................................................. DO_SPOTD: ................................................................................. CONSENSUS: ................................................................................. CONSENSUS_MOBI: .................................................................................