P51397 DAP1_HUMAN

Gene name: DAP
Protein name: Death-associated protein 1

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cellular nitrogen compound metabolic process GO:0034641
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9P2D1 CHD7 0.48095 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 P83916 CBX1 0.47936 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
response to stress GO:0006950
3 Q9H1R3 MYLK2 0.47767 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
4 P11387 TOP1 0.47542 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 Q13433 SLC39A6 0.47483 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
6 Q06323 PSME1 0.4728 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 Q92576 PHF3 0.46788 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 Q9UNY4 TTF2 0.46318 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
9 Q86SE9 PCGF5 0.46271 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
10 O00257 CBX4 0.45845 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MSSPPEGKLETKAGHPPAVKAGGMRIVQKHPHTGDTKEEKDKDDQEWESPSPPKPTVFISGVIARGDKDFPPAAAQVAHQKPHASMDKHPSPRTQHIQQP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDD.......................DDDDDDDDDDDDDD...D....................................DDDDDDDDD..D.....
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AH]:                                                                                       AAAqvAHqkpHA                
RICH_[AP]:                                                                                     PPAAAqvAhqkPhAsmdkhP          
RICH_[A]:                                                                               ArgdkdfppAAAqvA                      
RICH_[D]:                                                  DtkeekDkDD                                                        
RICH_[H]:                                                                                              HqkpHasmdkHpsprtqH    
RICH_[K]:                                            KhphtgdtKeeKdK                                                          
RICH_[Q]:                                                                                               QkphasmdkhpsprtQhiQQ 
RICH_[DE]:                                                 DtkEEkDkDDqEwE                                                    
RICH_[DH]:                                            HpHtgDtkeekDkDD                                                        
RICH_[DK]:                                           KhphtgDtKeeKDKDD                                                        
RICH_[EK]:                                           KhphtgdtKEEKdKddqEwE                                                    
RICH_[EP]:                                                    EEkdkddqEwEsPsPPkP                                             
RICH_[GP]:                  PPeGkletkaGhPPavkaGG                                                                             
RICH_[HQ]:                                                                                                       HpsprtQHiQQ 
RICH_[KP]:                                                   KeeKdKddqewesPsPPKP                                             
RICH_MOBI_[AF]:                                                                   FisgviArgdkdFppAAA                         
RICH_MOBI_[AH]:                                                                                  AAAqvAHqkpHA                
RICH_MOBI_[AI]:                                                                    IsgvIArgdkdfppAAAqvA                      
RICH_MOBI_[A]:                                                                          ArgdkdfppAAAqvA                      
RICH_MOBI_[D]:                                             DtkeekDkDD                                                        
RICH_MOBI_[H]:                                                                                         HqkpHasmdkHpsprtqH    
RICH_MOBI_[K]:                                       KhphtgdtKeeKdK                                                          
RICH_MOBI_[Q]:                                                                                          QkphasmdkhpsprtQhiQQ 
RICH_MOBI_[DE]:                                            DtkEEkDkDDqEwE                                                    
RICH_MOBI_[DH]:                                       HpHtgDtkeekDkDD                                                        
RICH_MOBI_[DK]:                                      KhphtgDtKeeKDKDD                                                        
RICH_MOBI_[EK]:                                      KhphtgdtKEEKdKddqEwE                                                    
RICH_MOBI_[FI]:                                                                   FIsgvIargdkdF                              
RICH_MOBI_[HQ]:                                                                                                  HpsprtQHiQQ 
RICH_fLPS_MOBI_[H]:                                                                                  vaHqkpHasmdkHpsprtqH    

                                           
AA:                      RK
STMI:                      
DO_DISOPRED3:            .D
DO_IUPRED2A:             DD
DO_SPOTD:                DD
CONSENSUS:               DD
CONSENSUS_MOBI:          DD