P51864 TDGF3_HUMAN
Gene name: TDGF1P3
Protein name: Putative teratocarcinoma-derived growth factor 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O75311 | GLRA3 | 0.81373 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 2 | O95750 | FGF19 | 0.75569 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 3 | Q13349 | ITGAD | 0.73279 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 immune system process GO:0002376 ... |
| 4 | P10909 | CLU | 0.61754 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 5 | O00591 | GABRP | 0.58168 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 6 | Q6NUI2 | GPAT2 | 0.5547 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 7 | Q14586 | ZNF267 | 0.49693 | anatomical structure development GO:0048856 |
| 8 | Q9UK10 | ZNF225 | 0.47464 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | Q9H7R0 | ZNF442 | 0.46369 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | P17097 | ZNF7 | 0.46135 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MDCRKMVRFSYSVIWIMAISKAFELGLVAGLGHQEFARPSRGDLAFRDDSIWPQEEPAIRPRSSQRVLPMGIQHSKELNRTCCLNGGTCMLESFCACPPS STMI: DO_DISOPRED3: D.D.DD.DD.........................DDD..DDDDD..DDDD..DDDDDDDDDDDDD................................... DO_IUPRED2A: ........................................................D.....DD.................................... DO_SPOTD: DDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS: DDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................... CONSENSUS_MOBI: .................................................................................................... RICH_[DF]: FarpsrgDlaFrDD
120 140 160 180 AA: FYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGICLSIQSYY STMI: DO_DISOPRED3: .....................................................................D.................. DO_IUPRED2A: ...............................................................D........................ DO_SPOTD: ........................................................................................ CONSENSUS: ........................................................................................ CONSENSUS_MOBI: ........................................................................................