P52565 GDIR1_HUMAN
Gene name: ARHGDIA
Protein name: Rho GDP-dissociation inhibitor 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cytoskeleton organization GO:0007010
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q15013 | MAD2L1BP | 0.84614 | cell cycle GO:0007049 mitotic cell cycle GO:0000278 mitotic nuclear division GO:0140014 |
| 2 | Q2KHN1 | RNF151 | 0.81982 | cell differentiation GO:0030154 cellular protein modification process GO:0006464 reproduction GO:0000003 |
| 3 | P27348 | YWHAQ | 0.77726 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 4 | Q8N7F7 | UBL4B | 0.76723 | protein targeting GO:0006605 protein transport GO:0015031 transport GO:0006810 |
| 5 | O95674 | CDS2 | 0.76248 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 |
| 6 | Q96C86 | DCPS | 0.74392 | catabolic process GO:0009056 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | A0A0U1RR37 | C1orf232 | 0.74375 | |
| 8 | P0C2W7 | CT47B1 | 0.73582 | |
| 9 | Q2M329 | CCDC96 | 0.7308 | |
| 10 | A6NES4 | MROH2A | 0.70362 |
20 40 60 80 100 AA: MAEQEPTAEQLAQIAAENEEDEHSVNYKPPAQKSIQEIQELDKDDESLRKYKEALLGRVAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKKQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD..........DD............................................................... DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDD.......DD............................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ RICH_[AE]: AEqEptAEqlAqiAAEnEEdE RICH_[AQ]: AeQeptAeQlAQiAA RICH_[A]: AeqeptAeqlAqiAA RICH_[E]: EqEptaEqlaqiaaEnEEdE RICH_[EN]: ENEEdEhsvN RICH_MOBI_[AE]: AEqEptAEqlAqiAAEnEEdE RICH_MOBI_[AQ]: AeQeptAeQlAQiAA RICH_MOBI_[A]: AeqeptAeqlAqiAA RICH_MOBI_[E]: EqEptaEqlaqiaaEnEEdE RICH_MOBI_[EN]: ENEEdEhsvN
120 140 160 180 200 AA: SFVLKEGVEYRIKISFRVNREIVSGMKYIQHTYRKGVKIDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTDDDKTDHLSWEWNLTIKK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: DWKD STMI: DO_DISOPRED3: .... DO_IUPRED2A: .... DO_SPOTD: .... CONSENSUS: .... CONSENSUS_MOBI: ....