P54710 ATNG_HUMAN
Gene name: FXYD2
Protein name: Sodium/potassium-transporting ATPase subunit gamma
List of terms from Generic GO subset, which this protein is a part of:
- circulatory system process GO:0003013
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P31942 | HNRNPH3 | 0.87077 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 2 | P62277 | RPS13 | 0.75926 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 3 | Q96F15 | GIMAP5 | 0.65792 | |
| 4 | Q9UNA3 | A4GNT | 0.65079 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell population proliferation GO:0008283 ... |
| 5 | Q9BSN7 | TMEM204 | 0.65079 | anatomical structure development GO:0048856 cell differentiation GO:0030154 signal transduction GO:0007165 |
| 6 | Q9H223 | EHD4 | 0.58209 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 7 | O43909 | EXTL3 | 0.58006 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 growth GO:0040007 ... |
| 8 | Q92995 | USP13 | 0.576 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 9 | Q92911 | SLC5A5 | 0.57023 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | Q8NHA8 | OR1F12 | 0.54639 | signal transduction GO:0007165 |
20 40 60 AA: MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDD.............................................DDDDDD DO_IUPRED2A: .DDDD.DD................................................DDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDD............. ..........DDDDDDDDDD CONSENSUS_MOBI: ............................ .................... RICH_[G]: GlsmdGGGspkG RICH_[GM]: MtGlsMdGGGspkG