P62277 RS13_HUMAN
Gene name: RPS13
Protein name: 40S ribosomal protein S13
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P54710 | FXYD2 | 0.75926 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | Q8TDV5 | GPR119 | 0.67267 | cell-cell signaling GO:0007267 protein transport GO:0015031 signal transduction GO:0007165 ... |
| 3 | Q96DX5 | ASB9 | 0.67175 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 4 | P31942 | HNRNPH3 | 0.60973 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q96G79 | SLC35A4 | 0.55815 | transport GO:0006810 |
| 6 | P51793 | CLCN4 | 0.50252 | transmembrane transport GO:0055085 transport GO:0006810 |
| 7 | Q96F15 | GIMAP5 | 0.4814 | |
| 8 | O43909 | EXTL3 | 0.42443 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 growth GO:0040007 ... |
| 9 | Q96JQ5 | MS4A4A | 0.39124 | |
| 10 | Q08043 | ACTN3 | 0.39029 | anatomical structure development GO:0048856 carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MGRMHAPGKGLSQSALPYRRSVPTWLKLTSDDVKEQIYKLAKKGLTPSQIGVILRDSHGVAQVRFVTGNKILRILKSKGLAPDLPEDLYHLIKKAVAVRK STMI: DO_DISOPRED3: DDDDDDDDDDD......................................................................................... DO_IUPRED2A: DDDDD.D..DD.DD...................................................................................... DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: DDDDDDDDDDDDDD...................................................................................... CONSENSUS_MOBI: D................................................................................................... RICH_[GM]: MGrMhapGkG
120 140 AA: HLERNRKDKDAKFRLILIESRIHRLARYYKTKRVLPPNWKYESSTASALVA STMI: DO_DISOPRED3: ................................................... DO_IUPRED2A: ................................................... DO_SPOTD: ...........................................DDDDDDDD CONSENSUS: ................................................... CONSENSUS_MOBI: ...................................................