P55075 FGF8_HUMAN
Gene name: FGF8
Protein name: Fibroblast growth factor 8
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell division GO:0051301
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- growth GO:0040007
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q11130 | FUT7 | 0.82752 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 2 | Q96BI1 | SLC22A18 | 0.82725 | transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | O95484 | CLDN9 | 0.82559 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 4 | Q9H9A6 | LRRC40 | 0.82487 | |
| 5 | Q9GZZ9 | UBA5 | 0.76162 | cellular protein modification process GO:0006464 nervous system process GO:0050877 response to stress GO:0006950 ... |
| 6 | Q86XM0 | CATSPERD | 0.75009 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 7 | P05111 | INHA | 0.72619 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | O75462 | CRLF1 | 0.72234 | anatomical structure development GO:0048856 cell death GO:0008219 cell population proliferation GO:0008283 ... |
| 9 | Q9NRM0 | SLC2A9 | 0.69203 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 transmembrane transport GO:0055085 ... |
| 10 | B2CW77 | KLLN | 0.6872 | cell cycle GO:0007049 cell death GO:0008219 |
20 40 60 80 100 AA: MGSPRSALSCLLLHLLVLCLQAQEGPGRGPALGRELASLFRAGREPQGVSQQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDP STMI: SSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.D...D..D.DDDDDDDDDDDDDDDDDDDDDDDDD....................................... DO_IUPRED2A: ...............................................D..DDDDDD............................................ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................... CONSENSUS_MOBI: .............................................................................. RICH_[QV]: QgVsQQhVreQslV RICH_[Q]: QgvsQQhvreQ RICH_[R]: RgpalgRelaslfRagR RICH_[GR]: GpGRGpalGRelaslfRaGR
120 140 160 180 200 AA: FAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGH STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDDD.. DO_SPOTD: ................................................................................DDDDD.............DD CONSENSUS: ................................................................................DDDDD............... CONSENSUS_MOBI: ..................................................................................................DD
220 AA: HTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR STMI: DO_DISOPRED3: ..........D.....DDDDDDDDDDDDDDDDD DO_IUPRED2A: ......................DDDDDDDDDDD DO_SPOTD: DDDDDDDDD...DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................DDDDDDDDDDDDDDDDD CONSENSUS_MOBI: DDDD.............................