P55089 UCN1_HUMAN

Gene name: UCN
Protein name: Urocortin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- generation of precursor metabolites and energy GO:0006091
- growth GO:0040007
- nervous system process GO:0050877
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- translation GO:0006412
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96AQ8 MCUR1 0.80426 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
2 Q17RB0 RTL8B 0.77436
3 Q8NCH0 CHST14 0.76018 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
4 Q6YI46 TMEM64 0.74676 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...
5 Q96DB5 RMDN1 0.73995
6 Q9NXS2 QPCTL 0.73102 cellular protein modification process GO:0006464
7 Q9H903 MTHFD2L 0.71538 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
8 Q8NCQ5 FBXO15 0.70608 cellular protein modification process GO:0006464
9 O95136 S1PR2 0.70192 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
10 Q7Z6M2 FBXO33 0.70054 catabolic process GO:0009056
cellular protein modification process GO:0006464

                                           20                  40                  60                  80                 100
AA:                      MRQAGRAALLAALLLLVQLCPGSSQRSPEAAGVQDPSLRWSPGARNQGGGARALLLLLAERFPRRAGPGRLGLGTAGERPRRDNPSLSIDLTFHLLRTLL
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSS                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D...DDDDDDDDDDDDDDDDDDDDD.................
DO_IUPRED2A:             .........................DDDDDDDDDDDDDDDDDDD........................DDDDDDDDDDDD.D.D................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............
CONSENSUS:                                        DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
CONSENSUS_MOBI:                                   DDDDDDDDDDDDDDDDDDDDD......................................................
RICH_[AG]:                                                         GArnqGGGArAlllllA                                         
RICH_[AL]:                                                          ArnqgggArALLLLLA                                         
RICH_[AR]:                                                                 ARAlllllAeRfpRRAgpgR                              
RICH_[G]:                                                                                  GpGrlGlGtaG                       
RICH_[L]:                                                                     LLLLLaerfprragpgrLgL                           
RICH_[R]:                                                            RnqgggaRalllllaeRfpRRagpgRlglgtageRpRR                  
RICH_[GL]:                                                    LrwspGarnqGGGaraLLLLL                                          
RICH_[GR]:                                                              GGGaRalllllaeRfpRRaG                                 
RICH_[LR]:                                                           RnqgggaRaLLLLLaeRfpRRagpgRLgL                           
RICH_fLPS_[L]:                                                           ggaraLLLLLaerfprragpgrLgL                           

                                          120                
AA:                      ELARTQSQRERAEQNRIIFDSVGK
STMI:                                            
DO_DISOPRED3:            .......................D
DO_IUPRED2A:             .....DD...D.DDDD........
DO_SPOTD:                ................DDDDDDDD
CONSENSUS:               .......................D
CONSENSUS_MOBI:          ........................