Q17RB0 RTL8B_HUMAN
Gene name: RTL8B
Protein name: Retrotransposon Gag-like protein 8B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O60930 | RNASEH1 | 0.83918 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 2 | Q96AQ8 | MCUR1 | 0.78351 | homeostatic process GO:0042592 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q96DB5 | RMDN1 | 0.78289 | |
| 4 | P55089 | UCN | 0.77436 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 5 | A6NJ08 | MBD3L5 | 0.73857 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9BU61 | NDUFAF3 | 0.73106 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 7 | Q8NHZ7 | MBD3L2 | 0.72791 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q8IYM2 | SLFN12 | 0.72358 | |
| 9 | Q9HBH5 | RDH14 | 0.72297 | cell differentiation GO:0030154 |
| 10 | Q96RP7 | GAL3ST4 | 0.72247 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell-cell signaling GO:0007267 |
20 40 60 80 100 AA: MEGRVQLMKALLARPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMFVDENTFSNDALKVTFLITRLTGPALQWVIPYIKKESPLLSDYRGFLAE STMI: DO_DISOPRED3: D...D.DDDDDDDDDDDDDDDDD............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[AL]: LmkALLArpLrpAA RICH_[AR]: RvqlmkAllARplRpAARR RICH_[L]: LmkaLLarpL RICH_[R]: RvqlmkallaRplRpaaRR RICH_[LR]: RvqLmkaLLaRpLRpaaRR
AA: MKRVFGWEEDEDF STMI: DO_DISOPRED3: ............D DO_IUPRED2A: ............. DO_SPOTD: ........DDDDD CONSENSUS: ............D CONSENSUS_MOBI: .............