P56555 DSCR4_HUMAN
Gene name: DSCR4
Protein name: Down syndrome critical region protein 4
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q13287 | NMI | 0.78928 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 2 | Q14D04 | VEPH1 | 0.72558 | signal transduction GO:0007165 |
| 3 | Q9UNN4 | GTF2A1L | 0.64616 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nervous system process GO:0050877 |
| 4 | P16234 | PDGFRA | 0.63341 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
| 5 | O94806 | PRKD3 | 0.61199 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 6 | O00161 | SNAP23 | 0.60232 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 immune system process GO:0002376 ... |
| 7 | Q86Y82 | STX12 | 0.5823 | catabolic process GO:0009056 cellular component assembly GO:0022607 membrane organization GO:0061024 ... |
| 8 | O00327 | ARNTL | 0.50105 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 9 | Q9P2I0 | CPSF2 | 0.49556 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 10 | Q96PE5 | OPALIN | 0.48657 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
20 40 60 80 100 AA: MSLIILTRDDEPRIFTPDSDAASPALHSTSPLPDPASASPLHREEKILPKVCNIVSCLSFSLPASPTDSGLASPTIITREGQQFWAKCLIWKYQLYLHGL STMI: DO_DISOPRED3: D................................................................................................... DO_IUPRED2A: ...............DDDDDD...DDDDDDDDDDDDDDDDD.D...........................DDDD.......................... DO_SPOTD: DD...............DDDDDDDDDDDDDD....DDD.............................................................. CONSENSUS: D................DDDDDDDDDDDDDD....DDD.............................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................. RICH_MOBI_[D]: DDepriftpDsD RICH_MOBI_[I]: IIltrddeprI RICH_MOBI_[DI]: IIltrDDeprIftpDsD RICH_fLPS_MOBI_[I]: IIltrddeprI
AA: HKKSDGRRDKQISASPST STMI: DO_DISOPRED3: ........DDDDDDDDDD DO_IUPRED2A: ......DDDDDDDDDDDD DO_SPOTD: .DDDDDDDDDDDDDDDDD CONSENSUS: ......DDDDDDDDDDDD CONSENSUS_MOBI: ..................