Q96PE5 OPALI_HUMAN

Gene name: OPALIN
Protein name: Opalin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y286 SIGLEC7 0.60742 cell adhesion GO:0007155
immune system process GO:0002376
2 Q9HCI6 KIAA1586 0.58279 cellular protein modification process GO:0006464
3 P21583 KITLG 0.52685 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
4 Q9BZV2 SLC19A3 0.51232 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
transmembrane transport GO:0055085
...
5 Q9Y4E5 ZNF451 0.50321 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 Q9H2G2 SLK 0.49904 cell adhesion GO:0007155
cell cycle GO:0007049
cell death GO:0008219
...
7 P16234 PDGFRA 0.49742 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
8 Q9Y603 ETV7 0.49441 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
9 O00422 SAP18 0.48663 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
10 P56555 DSCR4 0.48657

                                           20                  40                  60                  80                 100
AA:                      MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQE
STMI:                                                 MMMMMMMMMMMMMMMMMMMMM                                                  
DO_DISOPRED3:            DD.........................................................DDDDDDDDDD.....................DD........
DO_IUPRED2A:             .............DDDDDDDDDDDDDD.................................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDD....DDDDDDDDDDDDDDDDD...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS:               DD...........DDDDDDDDDDDD....                     .........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS_MOBI:          .............................                     ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.
RICH_[E]:                                                                            EamEEsdrpcEisE                          
RICH_[I]:                                                                                       IseIddnpkI                   
RICH_[DI]:                                                                                 DrpceIseIDDnpkI                   
RICH_[EI]:                                                                          IEamEEsdrpcEIsEI                         
RICH_[IN]:                                                                                         IddNpkIseN                
RICH_MOBI_[I]:                                                                                  IseIddnpkI                   
RICH_MOBI_[DI]:                                                                            DrpceIseIDDnpkI                   
RICH_MOBI_[EI]:                                                                         EEsdrpcEIsEIddnpkIsE                 
RICH_MOBI_[IN]:                                                                                    IddNpkIseN                
RICH_fLPS_MOBI_[I]:                                                                             IseIddnpkI                   

                                          120                 140                   
AA:                      AHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE
STMI:                                                             
DO_DISOPRED3:            .........................................
DO_IUPRED2A:             DDDD..DD......DDDDDDD....................
DO_SPOTD:                .........................................
CONSENSUS:               .........................................
CONSENSUS_MOBI:          .........................................