P57739 CLD2_HUMAN

Gene name: CLDN2
Protein name: Claudin-2

List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cellular component assembly GO:0022607

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P10747 CD28 0.90053 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
2 P62955 CACNG7 0.64023 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
3 O15393 TMPRSS2 0.62241 biological process involved in symbiotic interaction GO:0044403
protein maturation GO:0051604
4 Q02548 PAX5 0.61355 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
5 Q9UN30 SCML1 0.60897 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 Q9ULM6 CNOT6 0.60443 biosynthetic process GO:0009058
catabolic process GO:0009056
cell cycle GO:0007049
...
7 Q8N114 SHISA5 0.57815 cell death GO:0008219
cellular protein modification process GO:0006464
response to stress GO:0006950
...
8 P56749 CLDN12 0.56645 cell adhesion GO:0007155
homeostatic process GO:0042592
9 P17509 HOXB6 0.56365 anatomical structure development GO:0048856
embryo development GO:0009790
homeostatic process GO:0042592
...
10 A1KXE4 FAM168B 0.56185

                                           20                  40                  60                  80                 100
AA:                      MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVV
STMI:                           MMMMMMMMMMMMMMMMMMMMM                                                     MMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDD.DDDDDDDDDDDD....................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDD.................................................................................................
CONSENSUS:               DDD....                     .....................................................                   
CONSENSUS_MOBI:          .......                     .....................................................                   

                                          120                 140                 160                 180                 200
AA:                      GMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQA
STMI:                    MM              MMMMMMMMMMMMMMMMMMMMM                         MMMMMMMMMMMMMMMMMMMMM                 
DO_DISOPRED3:            ........................................................................................DDDDDDDDDDDD
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                .......................................................................................DDDDDDDDDDDDD
CONSENSUS:                 ..............                     .........................                     .....DDDDDDDDDDDD
CONSENSUS_MOBI:            ..............                     .........................                     .................
RICH_[PY]:                                                                                                             YdaYqa
RICH_[AY]:                                                                                                             YdAYqA
RICH_fLPS_[Y]:                                                                                                   rnrsnYYdaYqa

                                          220          
AA:                      QPLATRSSPRPGQPPKVKSEFNSYSLTGYV
STMI:                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD.DDDD
DO_IUPRED2A:             .....D.DDDDDD.D...............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDD..
CONSENSUS_MOBI:          ....DDDDDDDDDDDDDDDDDDD.......
RICH_[PY]:               qPlatrssPrPgqP                
RICH_[AY]:               qplA                          
RICH_fLPS_[Y]:           qpl