P10747 CD28_HUMAN
Gene name: CD28
Protein name: T-cell-specific surface glycoprotein CD28
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- mitotic nuclear division GO:0140014
- response to stress GO:0006950
- signal transduction GO:0007165
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P57739 | CLDN2 | 0.90053 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 2 | Q9ULM6 | CNOT6 | 0.79702 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 3 | O15393 | TMPRSS2 | 0.68125 | biological process involved in symbiotic interaction GO:0044403 protein maturation GO:0051604 |
| 4 | Q9Y5I7 | CLDN16 | 0.68118 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 5 | P54762 | EPHB1 | 0.66341 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 6 | Q9NR97 | TLR8 | 0.66335 | cellular protein modification process GO:0006464 immune system process GO:0002376 response to stress GO:0006950 ... |
| 7 | P56749 | CLDN12 | 0.64972 | cell adhesion GO:0007155 homeostatic process GO:0042592 |
| 8 | A1KXE4 | FAM168B | 0.64896 | |
| 9 | P55771 | PAX9 | 0.64145 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q02548 | PAX5 | 0.63549 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQ STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDD................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDD............................................................................................. CONSENSUS: .................................................................................. CONSENSUS_MOBI: ..................................................................................
120 140 160 180 200 AA: NLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPG STMI: MMMMMMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...................................................................................................D DO_IUPRED2A: .................................................................................................D.. DO_SPOTD: ............................................DDDDDDDDD...........................DDDDDDDDDDDDDDDDDDDD CONSENSUS: .................................................... ..................DDD CONSENSUS_MOBI: .................................................... ..................... RICH_[PY]: Pg