P58511 SI11A_HUMAN
Gene name: SMIM11A
Protein name: Small integral membrane protein 11A
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P38405 | GNAL | 0.9916 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 2 | P46059 | SLC15A1 | 0.98162 | protein transport GO:0015031 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | O95302 | FKBP9 | 0.97582 | protein folding GO:0006457 |
| 4 | P32456 | GBP2 | 0.9697 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 5 | P46721 | SLCO1A2 | 0.8951 | transport GO:0006810 |
| 6 | Q96MH7 | C5orf34 | 0.89277 | |
| 7 | Q9NS73 | MBIP | 0.88869 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 response to stress GO:0006950 ... |
| 8 | Q5FWF6 | ZNF789 | 0.87054 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | P20774 | OGN | 0.85497 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 10 | O14604 | TMSB4Y | 0.83631 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
20 40 AA: MNWKVLEHVPLLLYILAAKTLILCLTFAGVKMYQRKRLEAKQQKLEAERKKQSEKKDN STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................DDDDDDDDD DO_IUPRED2A: ...........................................DDDDDDDDDDDDDDD DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ......... ...........DDDDDDDDDDDDDDD CONSENSUS_MOBI: ......... .......................... RICH_[K]: KleaerKKqseKK RICH_[EK]: EaErKKqsEK