O14604 TYB4Y_HUMAN

Gene name: TMSB4Y
Protein name: Thymosin beta-4, Y-chromosomal

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BYD6 MRPL1 0.99146 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
2 O14818 PSMA7 0.98102 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 Q5FWF6 ZNF789 0.96392 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 P62328 TMSB4X 0.95097 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
5 Q14331 FRG1 0.92468 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
6 Q05901 CHRNB3 0.91226 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
7 P46721 SLCO1A2 0.90475 transport GO:0006810
8 Q8NEL0 CCDC54 0.89637
9 P49917 LIG4 0.89602 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 Q9HAW9 UGT1A8 0.89545 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281

                                           20                  40                
AA:                      MSDKPGMAEIEKFDKSKLKKTETQEKNPLSSKETIEQERQAGES
STMI:                                                                
DO_DISOPRED3:            DDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          D........................................DDD
RICH_[K]:                   KpgmaeieKfdKsKlKKtetqeKnplssK            
RICH_[EK]:                       EiEKfdKsKlKKtEtqEK                  
RICH_fLPS_[K]:                     eKfdKsKlKKtetqeKnplssK