P58549 FXYD7_HUMAN

Gene name: FXYD7
Protein name: FXYD domain-containing ion transport regulator 7

List of terms from Generic GO subset, which this protein is a part of:
- circulatory system process GO:0003013
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95759 TBC1D8 0.7306 cell population proliferation GO:0008283
circulatory system process GO:0003013
protein transport GO:0015031
...
2 Q400G9 AMZ1 0.60465
3 P61026 RAB10 0.58042 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell division GO:0051301
...
4 Q5TA76 LCE3A 0.50487 anatomical structure development GO:0048856
cell differentiation GO:0030154
response to stress GO:0006950
5 Q05823 RNASEL 0.47225 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
6 O00194 RAB27B 0.45539 cytoskeleton-dependent intracellular transport GO:0030705
protein transport GO:0015031
signal transduction GO:0007165
...
7 P35052 GPC1 0.44475 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
8 Q7Z4H9 FAM220A 0.44139 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
9 Q49AJ0 FAM135B 0.43541
10 Q5H9J9 TCP11X2 0.43359 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...

                                           20                  40                  60                  80                    
AA:                      MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV
STMI:                                           MMMMMMMMMMMMMMMMMMMMMMM                                  
DO_DISOPRED3:            DDDDDDDDDDDDDD............................................DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD............................................DDDDDDDD....DD.DDDD
DO_SPOTD:                DDDDDDDDDDDDDDDD...............................D.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD.......                       ............DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .......................                       .......DDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[CG]:                                                                             CksCkselpssapGGGG 
RICH_[CS]:                                                                          SptCkSCkSelpSS       
RICH_MOBI_[CG]:                                                                        CksCkselpssapGGGG 
RICH_MOBI_[CS]:                                                                 SrSeSptCkSCkSelpSS