P61026 RAB10_HUMAN
Gene name: RAB10
Protein name: Ras-related protein Rab-10
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- cell division GO:0051301
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- immune system process GO:0002376
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O00194 | RAB27B | 0.78459 | cytoskeleton-dependent intracellular transport GO:0030705 protein transport GO:0015031 signal transduction GO:0007165 ... |
| 2 | Q9UJY4 | GGA2 | 0.59302 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | P58549 | FXYD7 | 0.58042 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | H7C350 | CCDC188 | 0.53504 | |
| 5 | Q7Z4H9 | FAM220A | 0.53128 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 6 | Q05823 | RNASEL | 0.52689 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 7 | A0A1B0GUT2 | C10orf143 | 0.48728 | |
| 8 | Q06278 | AOX1 | 0.46874 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | O95759 | TBC1D8 | 0.4598 | cell population proliferation GO:0008283 circulatory system process GO:0003013 protein transport GO:0015031 ... |
| 10 | P61106 | RAB14 | 0.45049 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENI STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDD................................................................................................. CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: SKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC STMI: DO_DISOPRED3: ............................................................................DDDDDDDDDDDDDDDDDDDDD..D DO_IUPRED2A: ..................................D.D.....................................D.DDDDDDDDDDDD............ DO_SPOTD: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDD... CONSENSUS: ..........................................................................DDDDDDDDDDDDDDDDDDDDDDD... CONSENSUS_MOBI: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[CG]: GGGvtGwkskCC