P59103 DAOA_HUMAN
Gene name: DAOA
Protein name: D-amino acid oxidase activator
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NYU1 | UGGT2 | 0.76339 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 2 | Q9H3V2 | MS4A5 | 0.74524 | |
| 3 | P0CJ79 | ZNF888 | 0.72595 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | P17097 | ZNF7 | 0.70977 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q5QGT7 | RTP2 | 0.70711 | membrane organization GO:0061024 nervous system process GO:0050877 protein targeting GO:0006605 ... |
| 6 | P54750 | PDE1A | 0.68606 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 7 | Q8WYN0 | ATG4A | 0.67732 | catabolic process GO:0009056 protein transport GO:0015031 transport GO:0006810 |
| 8 | Q8WY07 | SLC7A3 | 0.51691 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 9 | Q9Y3D3 | MRPS16 | 0.51542 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 10 | Q5JPI3 | C3orf38 | 0.50702 | cell death GO:0008219 |
20 40 60 80 100 AA: MLEKLMGADSLQLFRSRYTLGKIYFIGFQRSILLSKSENSLNSIAKETEEGRETVTRKEGWKRRHEDGYLEMAQRHLQRSLCPWVSYLPQPYAELEEVSS STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: ...........................................DDDDDDD.DDDDDDDD......................................... DO_SPOTD: DDDDDDDD....................................DDDDDDDDDDDDDD.......................................... CONSENSUS: DDDD........................................DDDDDDDDDDDDDD.......................................... CONSENSUS_MOBI: .................................................................................................... RICH_[ET]: ETEEgrETvT
120 140 AA: HVGKVFMARNYEFLAYEASKDRRQPLERMWTCNYNQQKDQSCNHKEITSTKAE STMI: DO_DISOPRED3: .....................................DDDDDDDDDDDDDDDD DO_IUPRED2A: .............................DD.........DDDDDDDDDDDDD DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDD CONSENSUS: .....................................DDDDDDDDDDDDDDDD CONSENSUS_MOBI: .....................................................