Q9Y3D3 RT16_HUMAN

Gene name: MRPS16
Protein name: 28S ribosomal protein S16, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P61964 WDR5 0.68438 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
2 Q9NYU1 UGGT2 0.59957 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
3 Q9H3V2 MS4A5 0.59687
4 P0CJ79 ZNF888 0.59361 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 P54750 PDE1A 0.54677 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
6 O14798 TNFRSF10C 0.5448 cell death GO:0008219
signal transduction GO:0007165
7 Q5H9R4 ARMCX4 0.54246
8 P17097 ZNF7 0.53569 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
9 A6NNB3 IFITM5 0.52066 anatomical structure development GO:0048856
embryo development GO:0009790
10 Q96DT6 ATG4C 0.51542 catabolic process GO:0009056
protein transport GO:0015031
transport GO:0006810

                                           20                  40                  60                  80                 100
AA:                      MVHLTTLLCKAYRGGHLTIRLALGGCTNRPFYRIVAAHNKCPRDGRFVEQLGSYDPLPNSHGEKLVALNLDRIRHWIGCGAHLSKPMEKLLGLAGFFPLH
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDD.......................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DD..................................................................................................
CONSENSUS:                                                 ..................................................................
CONSENSUS_MOBI:                                            ..................................................................

                                          120   
AA:                      PMMITNAERLRRKRAREVLLASQKTDAEATDTEATET
STMI:                                                         
DO_DISOPRED3:            ..........DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ....................DDDDDDDDDDDDDDDDD
DO_SPOTD:                .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ..........DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....................................
RICH_[AE]:                               EvllAsqktdAEAtdtEAtE 
RICH_[AR]:                         RRkRARevllAsqktdAeA        
RICH_[AT]:                                   AsqkTdAeATdTeATeT
RICH_[T]:                                        TdaeaTdTeaTeT
RICH_[ET]:                               EvllasqkTdaEaTdTEaTET