P59773 MNARL_HUMAN
Gene name: MINAR2
Protein name: Major intrinsically disordered NOTCH2-binding receptor 1-like
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UHX3 | ADGRE2 | 0.87416 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | Q9H2U2 | PPA2 | 0.87416 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 ... |
| 3 | Q9NUX5 | POT1 | 0.87416 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q8NCT1 | ARRDC4 | 0.85359 | cellular protein modification process GO:0006464 protein transport GO:0015031 transport GO:0006810 |
| 5 | Q02363 | ID2 | 0.78979 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 6 | Q8TAG5 | VSTM2A | 0.78924 | cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 7 | P15907 | ST6GAL1 | 0.78688 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 8 | Q16445 | GABRA6 | 0.78187 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 9 | P41586 | ADCYAP1R1 | 0.78187 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 10 | Q9NPH3 | IL1RAP | 0.77804 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MDLSVLPNNNHPDKFLQLDVKSLTRSSALLQASLVRFPGGNYPAAQHWQNLVYSQREKKNIAAQRIRGSSADSLVTADSPPPSMSSVMKNNPLYGDLSLE STMI: DO_DISOPRED3: D.............................................................DDDDDDDDD.DD.DDD...................... DO_IUPRED2A: DDDDD.D........DDD.............................D.............DDDDD...DDDDDDDDDDDDDD.DDDD..........DD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDD........DDD.............................D.............DDDDDDDDDDDDDDDDDDDDDDDDDDD..........DD CONSENSUS_MOBI: .................................................................................................... RICH_[S]: SSadSlvtadSpppSmSS RICH_[MS]: SpppSMSSvM
120 140 160 180 AA: EAMEERKKNPSWTIEEYDKHSLHTNLSGHLKENPNDLRFWLGDMYTPGFDTLLKKEEKQEKHSKFCRMGLILLVVISILVTIVTIITFFT STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...................................................................D..DDDDDDDDDDDDDDD..DDD DO_IUPRED2A: D........DD..DD.........DD.D.............................................................. DO_SPOTD: DDD..............................................................D...DD...........DDDDDDDD CONSENSUS: D................................................................... D CONSENSUS_MOBI: .................................................................... .