P61758 PFD3_HUMAN
Gene name: VBP1
Protein name: Prefoldin subunit 3
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein folding GO:0006457
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H223 | EHD4 | 0.89443 | cellular component assembly GO:0022607 cellular protein modification process GO:0006464 protein-containing complex assembly GO:0065003 ... |
| 2 | Q92911 | SLC5A5 | 0.87622 | circulatory system process GO:0003013 transmembrane transport GO:0055085 transport GO:0006810 |
| 3 | Q8NHA8 | OR1F12 | 0.83957 | signal transduction GO:0007165 |
| 4 | P04629 | NTRK1 | 0.81373 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q14240 | EIF4A2 | 0.7928 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | Q9NRM2 | ZNF277 | 0.76822 | response to stress GO:0006950 |
| 7 | P36406 | TRIM23 | 0.76597 | biological process involved in symbiotic interaction GO:0044403 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | Q5T319 | FAM182B | 0.72161 | |
| 9 | Q9Y263 | PLAA | 0.70711 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 10 | Q9NZ38 | IDI2-AS1 | 0.70711 |
20 40 60 80 100 AA: MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPGNETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQTLEILKYMQKKKESTNS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .......DDD.D.D.DD..............................DD................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[G]: GkGematGnG
120 140 160 180 AA: METRFLLADNLYCKASVPPTDKMCLWLGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDSTKNKA STMI: DO_DISOPRED3: .......................................................................................DDDDDDDDDD DO_IUPRED2A: ..........................................................................................DDDDDDD DO_SPOTD: ....................................................................................DDDDDDDDDDDDD CONSENSUS: .......................................................................................DDDDDDDDDD CONSENSUS_MOBI: .................................................................................................