Q5T319 F182B_HUMAN

Gene name: FAM182B
Protein name: Protein FAM182B

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P57738 TCTA 0.94422 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
2 O15552 FFAR2 0.94255 cell differentiation GO:0030154
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
3 Q96BZ9 TBC1D20 0.91458 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
4 P47871 GCGR 0.89761 carbohydrate metabolic process GO:0005975
circulatory system process GO:0003013
generation of precursor metabolites and energy GO:0006091
...
5 P49840 GSK3A 0.89595 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
6 Q8N1Y9 n/a 0.89363
7 Q8WW01 TSEN15 0.88372 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
8 Q8IY22 CMIP 0.86826 anatomical structure development GO:0048856
embryo development GO:0009790
9 Q6ZRV3 LINC00696 0.861
10 Q14240 EIF4A2 0.8539 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MQEMVRELWMWNVEEEEHEVGICTWGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKVSATSSIAVYPCPGQSSGGAESPAPGPGLA
STMI:                                                                                                                        
DO_DISOPRED3:            D........................................................................................D..........
DO_IUPRED2A:             .................................D.DDDDDDDDDDDDDD.................................DDDDDDDDDDDDDDDD..
DO_SPOTD:                DD....................................................................DDDDDD.......DDDDDDDDDDDDDDDDD
CONSENSUS:               D..................................................................................DDDDDDDDDDDDDDD..
CONSENSUS_MOBI:          ....................................................................................................
RICH_[G]:                                                                                                   GqssGGaespapGpG  

                                          120                 140        
AA:                      GWSHLCGAALAEVQAAPVSQAAVSDASLGPEWSQEGCRPGLTSGQHGGRDGR
STMI:                                                                        
DO_DISOPRED3:            .......................................D..DDDDDDDDDD
DO_IUPRED2A:             ....................DDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                                            GpewsqeGcrpGltsGqhGGrdG 
RICH_fLPS_[G]:                                              GcrpGltsGqhGGrdG 
RICH_MOBI_[G]:                                       GpewsqeGcrpGltsGqhGGrdG