Q5T319 F182B_HUMAN
Gene name: FAM182B
Protein name: Protein FAM182B
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P57738 | TCTA | 0.94422 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
2 | O15552 | FFAR2 | 0.94255 |
cell differentiation
GO:0030154 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
3 | Q96BZ9 | TBC1D20 | 0.91458 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
4 | P47871 | GCGR | 0.89761 |
carbohydrate metabolic process
GO:0005975 circulatory system process GO:0003013 generation of precursor metabolites and energy GO:0006091 ... |
5 | P49840 | GSK3A | 0.89595 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
6 | Q8N1Y9 | n/a | 0.89363 | |
7 | Q8WW01 | TSEN15 | 0.88372 |
cellular nitrogen compound metabolic process
GO:0034641 mRNA processing GO:0006397 |
8 | Q8IY22 | CMIP | 0.86826 |
anatomical structure development
GO:0048856 embryo development GO:0009790 |
9 | Q6ZRV3 | LINC00696 | 0.861 | |
10 | Q14240 | EIF4A2 | 0.8539 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100
AA: MQEMVRELWMWNVEEEEHEVGICTWGGQHCGCPAKSLPGPHPGGVSAPQSASQLMVKLLVWQKSVHKLRKVSATSSIAVYPCPGQSSGGAESPAPGPGLA
STMI:
DO_DISOPRED3: D........................................................................................D..........
DO_IUPRED2A: .................................D.DDDDDDDDDDDDDD.................................DDDDDDDDDDDDDDDD..
DO_SPOTD: DD....................................................................DDDDDD.......DDDDDDDDDDDDDDDDD
CONSENSUS: D..................................................................................DDDDDDDDDDDDDDD..
CONSENSUS_MOBI: ....................................................................................................
RICH_[G]: GqssGGaespapGpG
120 140
AA: GWSHLCGAALAEVQAAPVSQAAVSDASLGPEWSQEGCRPGLTSGQHGGRDGR
STMI:
DO_DISOPRED3: .......................................D..DDDDDDDDDD
DO_IUPRED2A: ....................DDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS: ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ...................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]: GpewsqeGcrpGltsGqhGGrdG
RICH_fLPS_[G]: GcrpGltsGqhGGrdG
RICH_MOBI_[G]: GpewsqeGcrpGltsGqhGGrdG