P61952 GBG11_HUMAN
Gene name: GNG11
Protein name: Guanine nucleotide-binding protein G
List of terms from Generic GO subset, which this protein is a part of:
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8IXT1 | DDIAS | 0.95809 | cell cycle GO:0007049 cell death GO:0008219 mitotic cell cycle GO:0000278 ... |
| 2 | Q9NYT6 | ZNF226 | 0.94031 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 3 | Q96CW1 | AP2M1 | 0.9395 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 4 | A0A1B0GVH7 | IQCM | 0.87026 | |
| 5 | Q9UKY0 | PRND | 0.81068 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 ... |
| 6 | Q96EY4 | TMA16 | 0.79319 | |
| 7 | Q9Y6U3 | SCIN | 0.77655 | |
| 8 | P16333 | NCK1 | 0.76592 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 9 | Q8IZC4 | RTKN2 | 0.75616 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 10 | P17706 | PTPN2 | 0.72345 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
20 40 60 AA: MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSCVIS STMI: DO_DISOPRED3: DDDDD.................................................................... DO_IUPRED2A: DDDDDDDDDDD...D.D.......................DD.......DDDDDDDDDDDD......D..... DO_SPOTD: DDDDDDDDDDD.............................................................D CONSENSUS: DDDDDDDDDDD.............................................................. CONSENSUS_MOBI: ..................................................DDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[K]: KgipedKnpfKeK RICH_MOBI_[IK]: KgIpedKnpfKeKgscvI