Q9UKY0 PRND_HUMAN
Gene name: PRND
Protein name: Prion-like protein doppel
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
- reproduction GO:0000003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q8NBZ7 | UXS1 | 0.82221 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
2 | P61952 | GNG11 | 0.81068 | signal transduction GO:0007165 |
3 | Q8IXT1 | DDIAS | 0.70171 | cell cycle GO:0007049 cell death GO:0008219 mitotic cell cycle GO:0000278 ... |
4 | Q96CW1 | AP2M1 | 0.67291 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
5 | A0A1B0GVH7 | IQCM | 0.63667 | |
6 | Q9NYT6 | ZNF226 | 0.63363 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
7 | O15165 | LDLRAD4 | 0.60705 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
8 | Q96EY4 | TMA16 | 0.55645 | |
9 | Q9Y6U3 | SCIN | 0.5562 | |
10 | P16333 | NCK1 | 0.54858 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDFGAEGNRYYEANYWQFPDGIHYNGCSEANVT STMI: SSSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDD..DDD...........................DDD.DDDDD...................................................... DO_IUPRED2A: .............................................DD..................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................. CONSENSUS: ............DDDDDDDDDD..................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDD................................................. RICH_MOBI_[IK]: IKhrIKwnrK
120 140 160 AA: KEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELCSLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK STMI: DO_DISOPRED3: ............................................................................ DO_IUPRED2A: ...................D........................................................ DO_SPOTD: ............................................................................ CONSENSUS: ............................................................................ CONSENSUS_MOBI: ..................................................DD........................