P62072 TIM10_HUMAN
Gene name: TIMM10
Protein name: Mitochondrial import inner membrane translocase subunit Tim10
List of terms from Generic GO subset, which this protein is a part of:
- membrane organization GO:0061024
- nervous system process GO:0050877
- protein targeting GO:0006605
- protein transport GO:0015031
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96A37 | RNF166 | 0.83205 | catabolic process GO:0009056 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 2 | Q8NEH6 | MNS1 | 0.81373 | anatomical structure development GO:0048856 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 3 | Q96PP8 | GBP5 | 0.79262 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
| 4 | Q15437 | SEC23B | 0.76822 | membrane organization GO:0061024 protein transport GO:0015031 transport GO:0006810 ... |
| 5 | Q96PP9 | GBP4 | 0.7282 | immune system process GO:0002376 response to stress GO:0006950 |
| 6 | Q96RD7 | PANX1 | 0.61964 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 7 | Q9NWZ3 | IRAK4 | 0.61964 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | Q9UFF9 | CNOT8 | 0.58835 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 9 | Q9Y694 | SLC22A7 | 0.53746 | transport GO:0006810 |
| 10 | P32455 | GBP1 | 0.52981 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
20 40 60 80 AA: MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA STMI: DO_DISOPRED3: D....................................................................................DDDDD DO_IUPRED2A: .D...................................................................DDDDDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDD..................................................................DDDDDDDDDDDDDDDDDD CONSENSUS: DD......................................................................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .......................................................................................... RICH_[MQ]: MQdeelMkrvQQ