Q96A37 RN166_HUMAN
Gene name: RNF166
Protein name: E3 ubiquitin-protein ligase RNF166
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P62072 | TIMM10 | 0.83205 | membrane organization GO:0061024 nervous system process GO:0050877 protein targeting GO:0006605 ... |
| 2 | Q8NEH6 | MNS1 | 0.67707 | anatomical structure development GO:0048856 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 3 | Q96PP8 | GBP5 | 0.6595 | cellular component assembly GO:0022607 immune system process GO:0002376 protein-containing complex assembly GO:0065003 ... |
| 4 | Q15437 | SEC23B | 0.6392 | membrane organization GO:0061024 protein transport GO:0015031 transport GO:0006810 ... |
| 5 | Q96PP9 | GBP4 | 0.6059 | immune system process GO:0002376 response to stress GO:0006950 |
| 6 | Q9UI12 | ATP6V1H | 0.5547 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 homeostatic process GO:0042592 ... |
| 7 | Q9NWZ3 | IRAK4 | 0.51558 | cell population proliferation GO:0008283 cellular protein modification process GO:0006464 immune system process GO:0002376 ... |
| 8 | Q8TAC9 | SCAMP5 | 0.5127 | cell-cell signaling GO:0007267 protein transport GO:0015031 response to stress GO:0006950 ... |
| 9 | Q9UFF9 | CNOT8 | 0.48954 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell cycle GO:0007049 ... |
| 10 | Q9Y694 | SLC22A7 | 0.4472 | transport GO:0006810 |
20 40 60 80 100 AA: MAMFRSLVASAQQRQPPAGPAGGDSGLEAQYTCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLCPLCRLPFDPKKVDKATHVEKQLSSYKAPCRG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDD.D......................................................................... DO_IUPRED2A: .............DDDDDDDDD................................................................D............. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDD.D........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AQ]: AsAQQrQppA RICH_[MQ]: MaMfrslvasaQQrQ
120 140 160 180 200 AA: CNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANF STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: LQHLLHRHKFSYDTFVDYSIDEEAAFQAALALSLSEN STMI: DO_DISOPRED3: ....................................D DO_IUPRED2A: ..................................... DO_SPOTD: ...............................DDDDDD CONSENSUS: ....................................D CONSENSUS_MOBI: .....................................