P63000 RAC1_HUMAN
Gene name: RAC1
Protein name: Ras-related C3 botulinum toxin substrate 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P57057 | SLC37A1 | 0.74927 | transmembrane transport GO:0055085 transport GO:0006810 |
| 2 | P08567 | PLEK | 0.70957 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q9ULB4 | CDH9 | 0.70711 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 4 | Q06730 | ZNF33A | 0.68279 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q14168 | MPP2 | 0.6619 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 6 | Q69YU5 | BRAWNIN | 0.64249 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 7 | Q9GZV3 | SLC5A7 | 0.63652 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell-cell signaling GO:0007267 ... |
| 8 | Q99578 | RIT2 | 0.63091 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 9 | Q4J6C6 | PREPL | 0.62974 | cell-cell signaling GO:0007267 protein transport GO:0015031 transport GO:0006810 ... |
| 10 | Q16787 | LAMA3 | 0.60971 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPE STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: VRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL STMI: DO_DISOPRED3: ...............................................................................DDDDD.DDDD..D DO_IUPRED2A: ............................................................................................ DO_SPOTD: ................................................................................DDDDDDDDDDDD CONSENSUS: ................................................................................DDDDDDDDDDDD CONSENSUS_MOBI: .........................................................................................DDD RICH_[KL]: KKrKrKcLLL