P63313 TYB10_HUMAN

Gene name: TMSB10
Protein name: Thymosin beta-10

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UKF2 ADAM30 0.88845 reproduction GO:0000003
2 P0CG35 TMSB15B 0.85961 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
3 O75586 MED6 0.80448 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
4 Q9NVP1 DDX18 0.78134 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
5 Q13061 TRDN 0.76158 circulatory system process GO:0003013
cytoskeleton organization GO:0007010
homeostatic process GO:0042592
...
6 O60669 SLC16A7 0.7492 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
7 Q9NZH5 PTTG2 0.73554 cell cycle GO:0007049
chromosome organization GO:0051276
chromosome segregation GO:0007059
...
8 Q1ED39 KNOP1 0.73039
9 Q8IZU0 FAM9B 0.72102 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
10 Q9Y2B4 TP53TG5 0.7164 growth GO:0040007
signal transduction GO:0007165

                                           20                  40                
AA:                      MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
STMI:                                                                
DO_DISOPRED3:            DDD....DDD..D..DDDDDDDDDDDDDDDDDDDDDDDD.DDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                                                EtiEqEkrsE  
RICH_[K]:                   KpdmgeiasfdKaKlKKtetqeKntlptKetieqeK     
RICH_[T]:                                    TeTqeknTlpTkeT          
RICH_[DM]:               MaDkpDMgeiasfD                              
RICH_[EK]:                               KlKKtEtqEKntlptKEtiEqEK     
RICH_[ET]:                                   TETqEknTlpTkETiEqEkrsE  
RICH_[KT]:                             KaKlKKTeTqeKnTlpTKeTieqeK     
RICH_fLPS_[K]:                       fdKaKlKKtetqeKntlptK            
RICH_MOBI_[E]:                                           EtiEqEkrsE  
RICH_MOBI_[K]:              KpdmgeiasfdKaKlKKtetqeKntlptKetieqeK     
RICH_MOBI_[T]:                               TeTqeknTlpTkeT          
RICH_MOBI_[DM]:          MaDkpDMgeiasfD                              
RICH_MOBI_[EI]:                                  EkntlptkEtIEqEkrsEI 
RICH_MOBI_[EK]:                          KlKKtEtqEKntlptKEtiEqEK     
RICH_MOBI_[ET]:                              TETqEknTlpTkETiEqEkrsE  
RICH_MOBI_[KM]:          MadKpdMgeiasfdKaKlKK                        
RICH_MOBI_[KT]:                        KaKlKKTeTqeKnTlpTKeTieqeK     
RICH_fLPS_MOBI_[K]:                  fdKaKlKKtetqeKntlptK