P63316 TNNC1_HUMAN
Gene name: TNNC1
Protein name: Troponin C, slow skeletal and cardiac muscles
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- circulatory system process GO:0003013
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P11926 | ODC1 | 0.83931 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | A6NH52 | TVP23A | 0.83205 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | O43934 | MFSD11 | 0.81373 | |
| 4 | Q96D46 | NMD3 | 0.78811 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 nucleocytoplasmic transport GO:0006913 ... |
| 5 | P10523 | SAG | 0.7282 | signal transduction GO:0007165 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 6 | Q6UWV2 | MPZL3 | 0.70711 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 |
| 7 | Q9BQE3 | TUBA1C | 0.70711 | cell cycle GO:0007049 cell division GO:0051301 cytoskeleton organization GO:0007010 ... |
| 8 | Q8IX95 | CTAGE3P | 0.69673 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 9 | Q2NL67 | PARP6 | 0.68599 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | Q8TEX9 | IPO4 | 0.66997 | cellular component assembly GO:0022607 chromosome organization GO:0051276 nucleocytoplasmic transport GO:0006913 ... |
20 40 60 80 100 AA: MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRCMKDDSKGKSEEELSDL STMI: DO_DISOPRED3: DDDDDDD............................................................................................. DO_IUPRED2A: .............................................DDDDD.DDDDDDDDDDDDDDD.................................. DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: DDDDDDD............................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 AA: FRMFDKNADGYIDLDELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE STMI: DO_DISOPRED3: ...........................DDDDDDDDDDDDDDDDDDDD.............. DO_IUPRED2A: ........................D....DDDDDDDDDDDDD................... DO_SPOTD: ............................................................. CONSENSUS: .............................DDDDDDDDDDDDD................... CONSENSUS_MOBI: ............................................................. RICH_[DE]: EDDiEElmkD