List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9Y2S6	TMA7	0.81587	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
2	A0A024R1R8	hCG_2014768	0.8033	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
3	Q9BXJ9	NAA15	0.77296	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ...
4	P42696	RBM34	0.76959
5	P0DMP2	SRGAP2B	0.7619	anatomical structure development GO:0048856
6	Q8TEA8	DTD1	0.76101	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
7	Q9GZR2	REXO4	0.75895	biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ...
8	O75475	PSIP1	0.75362	biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ...
9	P22492	H1-6	0.75197	anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ...
10	Q9H098	FAM107B	0.74956

                                           20                  40 
AA:                      MTRGNQRELARQKNMKKQSDSVKGKRRDDGLSAAARKQRDSEIMQQKQKKANEKKEEPK
STMI:                                                                               
DO_DISOPRED3:            DDDD...D.............................................DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AK]:                                               AAArKqrdseimqqKqKKA        
RICH_[AQ]:                                               AAArkQrdseimQQkQkkA        
RICH_[K]:                            KnmKKqsdsvKgK           KqrdseimqqKqKKaneKKeepK
RICH_[Q]:                                                     QrdseimQQkQ           
RICH_[R]:                                         RRddglsaaaRkqR                    
RICH_[EK]:                                                        EimqqKqKKanEKKEEpK
RICH_[EQ]:                                                    QrdsEimQQkQkkanEkkEE  
RICH_[KQ]:                                                   KQrdseimQQKQKKaneKKeepK
RICH_fLPS_[K]:                                              rKqrdseimqqKqKKaneKK    
RICH_MOBI_[AK]:                                          AAArKqrdseimqqKqKKA        
RICH_MOBI_[AQ]:                                          AAArkQrdseimQQkQkkA        
RICH_MOBI_[K]:                       KnmKKqsdsvKgK           KqrdseimqqKqKKaneKKeepK
RICH_MOBI_[Q]:                                                QrdseimQQkQ           
RICH_MOBI_[R]:                                    RRddglsaaaRkqR                    
RICH_MOBI_[EK]:                                                   EimqqKqKKanEKKEEpK
RICH_MOBI_[EQ]:                                               QrdsEimQQkQkkanEkkEE  
RICH_MOBI_[KQ]:                                              KQrdseimQQKQKKaneKKeepK
RICH_fLPS_MOBI_[K]:                                         rKqrdseimqqKqKKaneKK