List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- translation GO:0006412

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9Y2S6	TMA7	0.88151	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412
2	Q9BXJ9	NAA15	0.86651	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ...
3	Q9H098	FAM107B	0.83601
4	Q8NE71	ABCF1	0.82643	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 response to stress GO:0006950 ...
5	P0DMP2	SRGAP2B	0.82616	anatomical structure development GO:0048856
6	O75475	PSIP1	0.81103	biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular component assembly GO:0022607 ...
7	P0DJJ0	SRGAP2C	0.8085	anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ...
8	P84101	SERF2	0.8033
9	Q14690	PDCD11	0.78931	cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ribosome biogenesis GO:0042254
10	Q9Y421	FAM32A	0.78127	cell cycle GO:0007049 cell death GO:0008219

                                           20                  40                  60                
AA:                      MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK
STMI:                                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDD.........................................DDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
RICH_[E]:                                    EmdEEEkafkqkqkEEqkklE                       
RICH_[G]:                                                                GkGplatGGikksG  
RICH_[K]:                       KKKalKqpKKqaKemdeeeKafKqKqKeeqKKlevlKaKvvgKgplatggiKKsgKK
RICH_[Q]:                             QpkkQakemdeeekafkQkQ                               
RICH_[EK]:                      KKKalKqpKKqaKEmdEEEKafKqKqKEEqKKlEvlK                    
RICH_[EQ]:                            QpkkQakEmdEEEkafkQkQkEEQ                           
RICH_[GK]:                                                    KKlevlKaKvvGKGplatGGiKKsGKK
RICH_[KQ]:                            QpKKQaKemdeeeKafKQKQKeeQKKlevlK                    
RICH_[KV]:                                                KeeqKKleVlKaKVV                
RICH_fLPS_[K]:                ggKKKalKqpKKqaKemdeeeKafKqKqKeeqKKlevlKaKvvgK              
RICH_MOBI_[E]:                               EmdEEEkafkqkqkEE                            
RICH_MOBI_[K]:                  KKKalKqpKKqaKemdeeeKafKqKqKeeqK                          
RICH_MOBI_[Q]:                        QpkkQakemdeeekafkQkQ                               
RICH_MOBI_[EK]:                 KKKalKqpKKqaKEmdEEEKafKqKqKEEqK                          
RICH_MOBI_[EQ]:                       QpkkQakEmdEEEkafkQkQkEEQ                           
RICH_MOBI_[KQ]:                       QpKKQaKemdeeeKafKQKQKeeQK                          
RICH_fLPS_MOBI_[K]:           ggKKKalKqpKKqaKemdeeeKafKqKqKeeqK