Q00688 FKBP3_HUMAN
Gene name: FKBP3
Protein name: Peptidyl-prolyl cis-trans isomerase FKBP3
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P53618 | COPB1 | 0.92478 | biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 protein transport GO:0015031 ... |
| 2 | Q9H169 | STMN4 | 0.92314 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cytoskeleton organization GO:0007010 |
| 3 | P32456 | GBP2 | 0.82282 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
| 4 | P12882 | MYH1 | 0.82242 | |
| 5 | O95302 | FKBP9 | 0.81946 | protein folding GO:0006457 |
| 6 | P46721 | SLCO1A2 | 0.81869 | transport GO:0006810 |
| 7 | P16591 | FER | 0.81278 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 8 | P38405 | GNAL | 0.80361 | nervous system process GO:0050877 signal transduction GO:0007165 |
| 9 | O43529 | CHST10 | 0.7982 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell adhesion GO:0007155 |
| 10 | Q6ZS27 | ZNF662 | 0.77599 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80 100 AA: MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQEHGSDSFLAEHKLLGNIKNVAKTANKDHLVTAYNHLFETKRFKGTESISKVSEQVKNVKLNEDKPKETKS STMI: DO_DISOPRED3: DDDDDD.....................................................................................DDDDDDDDD DO_IUPRED2A: ............DD...........D........................................................DDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDD.....................................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDD............................................................................DDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EdkpkEtks RICH_[K]: KnvKlnedKpKetK RICH_[EK]: EqvKnvKlnEdKpKEtKs RICH_[KN]: KNvKlNedKpK
120 140 160 180 200 AA: EETLDEGPPKYTKSVLKKGDKTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSAKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEWAYGK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: DDDDDDDDDDDDD.DDDDD............................D.DD.........................................DDDDD..D DO_SPOTD: DDDDDDD............................................................................................. CONSENSUS: DDDDDDD............................................................................................. CONSENSUS_MOBI: .................................................................................................... RICH_[E]: EEtldE RICH_[EK]: EEtldE
220 AA: KGQPDAKIPPNAKLTFEVELVDID STMI: DO_DISOPRED3: ........................ DO_IUPRED2A: DDDDD...D............... DO_SPOTD: ........................ CONSENSUS: ........................ CONSENSUS_MOBI: ........................